Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1240986..1241903 | Replicon | chromosome |
Accession | NZ_CP099460 | ||
Organism | Bacillus velezensis strain E |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | NF199_RS06515 | Protein ID | WP_007407256.1 |
Coordinates | 1241157..1241903 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NF199_RS06510 | Protein ID | WP_003154807.1 |
Coordinates | 1240986..1241156 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF199_RS06470 | 1236222..1237841 | + | 1620 | WP_265606232.1 | pyocin knob domain-containing protein | - |
NF199_RS06475 | 1237854..1238225 | + | 372 | WP_032874603.1 | XkdW family protein | - |
NF199_RS06480 | 1238230..1238427 | + | 198 | WP_032874605.1 | XkdX family protein | - |
NF199_RS06485 | 1238484..1239245 | + | 762 | WP_032874607.1 | hypothetical protein | - |
NF199_RS06490 | 1239297..1239560 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NF199_RS06495 | 1239574..1239837 | + | 264 | WP_003154813.1 | phage holin | - |
NF199_RS06500 | 1239851..1240729 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
NF199_RS06505 | 1240764..1240889 | - | 126 | WP_003154809.1 | hypothetical protein | - |
NF199_RS06510 | 1240986..1241156 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NF199_RS06515 | 1241157..1241903 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NF199_RS06520 | 1242008..1243006 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
NF199_RS06525 | 1243019..1243636 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
NF199_RS06530 | 1243924..1245237 | - | 1314 | Protein_1225 | amino acid permease | - |
NF199_RS06535 | 1245559..1246509 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T248911 WP_007407256.1 NZ_CP099460:c1241903-1241157 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|