Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 4131636..4132278 | Replicon | chromosome |
| Accession | NZ_CP099450 | ||
| Organism | Bacillus pacificus strain ANSB901 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | NE411_RS21755 | Protein ID | WP_000635963.1 |
| Coordinates | 4131928..4132278 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | NE411_RS21750 | Protein ID | WP_000004570.1 |
| Coordinates | 4131636..4131923 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE411_RS21725 (NE411_21680) | 4126962..4127924 | + | 963 | WP_000961156.1 | UV DNA damage repair endonuclease UvsE | - |
| NE411_RS21730 (NE411_21685) | 4127917..4128489 | - | 573 | WP_000907063.1 | rhomboid family intramembrane serine protease | - |
| NE411_RS21735 (NE411_21690) | 4128582..4128941 | + | 360 | WP_000635037.1 | holo-ACP synthase | - |
| NE411_RS21740 (NE411_21695) | 4129098..4130048 | + | 951 | WP_029141035.1 | outer membrane lipoprotein carrier protein LolA | - |
| NE411_RS21745 (NE411_21700) | 4130167..4131336 | + | 1170 | WP_000390608.1 | alanine racemase | - |
| NE411_RS21750 (NE411_21705) | 4131636..4131923 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| NE411_RS21755 (NE411_21710) | 4131928..4132278 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NE411_RS21760 (NE411_21715) | 4132346..4134514 | + | 2169 | WP_000426205.1 | Tex family protein | - |
| NE411_RS21765 (NE411_21720) | 4134572..4134688 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| NE411_RS21770 (NE411_21725) | 4134884..4135342 | + | 459 | WP_000344243.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T248909 WP_000635963.1 NZ_CP099450:4131928-4132278 [Bacillus pacificus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |