Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 1034748..1035721 | Replicon | chromosome |
Accession | NZ_CP099450 | ||
Organism | Bacillus pacificus strain ANSB901 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NE411_RS05395 | Protein ID | WP_014893739.1 |
Coordinates | 1034748..1035485 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A151UPU1 |
Locus tag | NE411_RS05400 | Protein ID | WP_000588714.1 |
Coordinates | 1035593..1035721 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE411_RS05370 (NE411_05355) | 1029830..1030612 | + | 783 | WP_000381777.1 | class I SAM-dependent methyltransferase | - |
NE411_RS05375 (NE411_05360) | 1030790..1032475 | - | 1686 | WP_011040340.1 | alpha-keto acid decarboxylase family protein | - |
NE411_RS05380 (NE411_05365) | 1032583..1033065 | + | 483 | WP_000191907.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NE411_RS05385 (NE411_05370) | 1033172..1033336 | + | 165 | Protein_1072 | transposase | - |
NE411_RS05390 (NE411_05375) | 1033673..1034410 | + | 738 | WP_000594137.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
NE411_RS05395 (NE411_05380) | 1034748..1035485 | + | 738 | WP_014893739.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NE411_RS05400 (NE411_05385) | 1035593..1035721 | + | 129 | WP_000588714.1 | hypothetical protein | Antitoxin |
NE411_RS05405 (NE411_05390) | 1035794..1035970 | + | 177 | WP_000852590.1 | stage II sporulation protein SB | - |
NE411_RS05410 (NE411_05395) | 1035989..1036378 | - | 390 | WP_000714180.1 | YxeA family protein | - |
NE411_RS05415 (NE411_05400) | 1036595..1038064 | + | 1470 | WP_000287562.1 | beta-Ala-His dipeptidase | - |
NE411_RS05420 (NE411_05405) | 1038265..1038871 | + | 607 | Protein_1079 | CatB-related O-acetyltransferase | - |
NE411_RS05425 (NE411_05410) | 1039315..1040628 | + | 1314 | WP_000677730.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28351.07 Da Isoelectric Point: 8.2998
>T248908 WP_014893739.1 NZ_CP099450:1034748-1035485 [Bacillus pacificus]
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMVKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPFEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMVKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPFEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|