Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 102166..102809 Replicon plasmid pSKLX33367_KPC2
Accession NZ_CP099415
Organism Klebsiella pneumoniae strain 33367

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NE847_RS28830 Protein ID WP_001044770.1
Coordinates 102166..102582 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NE847_RS28835 Protein ID WP_001261282.1
Coordinates 102579..102809 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE847_RS28810 (98269) 98269..98541 - 273 Protein_121 transposase -
NE847_RS28820 (99523) 99523..100545 - 1023 WP_000361404.1 helicase UvrD -
NE847_RS28825 (100530) 100530..102092 - 1563 WP_004206609.1 AAA family ATPase -
NE847_RS28830 (102166) 102166..102582 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NE847_RS28835 (102579) 102579..102809 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NE847_RS28840 (102766) 102766..103227 + 462 WP_014343465.1 hypothetical protein -
NE847_RS28845 (103388) 103388..104332 + 945 WP_011977810.1 hypothetical protein -
NE847_RS28850 (104369) 104369..104761 + 393 WP_011977811.1 hypothetical protein -
NE847_RS28855 (104819) 104819..105340 + 522 WP_013214008.1 hypothetical protein -
NE847_RS28860 (105386) 105386..105589 + 204 WP_011977813.1 hypothetical protein -
NE847_RS28865 (105619) 105619..106623 + 1005 WP_011977814.1 hypothetical protein -
NE847_RS28870 (106807) 106807..107586 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..150096 150096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T248905 WP_001044770.1 NZ_CP099415:c102582-102166 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT248905 WP_001261282.1 NZ_CP099415:c102809-102579 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References