Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 142714..143384 Replicon plasmid pSKLX33367_VIR
Accession NZ_CP099414
Organism Klebsiella pneumoniae strain 33367

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NE847_RS27810 Protein ID WP_004213072.1
Coordinates 142714..143157 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NE847_RS27815 Protein ID WP_004213073.1
Coordinates 143154..143384 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE847_RS27775 (NE847_27775) 138125..138400 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NE847_RS27780 (NE847_27780) 138463..138954 + 492 WP_011251327.1 DM13 domain-containing protein -
NE847_RS27785 (NE847_27785) 139003..139923 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NE847_RS27790 (NE847_27790) 140014..140417 + 404 Protein_152 GAF domain-containing protein -
NE847_RS27795 (NE847_27795) 140935..141570 - 636 Protein_153 mucoid phenotype regulator RmpA2 -
NE847_RS27800 (NE847_27800) 141987..142291 + 305 Protein_154 transposase -
NE847_RS27805 (NE847_27805) 142314..142565 - 252 WP_186987481.1 hypothetical protein -
NE847_RS27810 (NE847_27810) 142714..143157 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NE847_RS27815 (NE847_27815) 143154..143384 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NE847_RS27820 (NE847_27820) 143992..145125 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NE847_RS27825 (NE847_27825) 145141..145434 + 294 WP_004213076.1 hypothetical protein -
NE847_RS27830 (NE847_27830) 145424..145630 - 207 WP_004213077.1 hypothetical protein -
NE847_RS27835 (NE847_27835) 145982..146272 + 291 WP_004213078.1 hypothetical protein -
NE847_RS27840 (NE847_27840) 146262..147161 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..215836 215836


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T248901 WP_004213072.1 NZ_CP099414:c143157-142714 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT248901 WP_004213073.1 NZ_CP099414:c143384-143154 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References