Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4912664..4913180 | Replicon | chromosome |
Accession | NZ_CP099413 | ||
Organism | Klebsiella pneumoniae strain 33367 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | NE847_RS24360 | Protein ID | WP_002886902.1 |
Coordinates | 4912664..4912948 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NE847_RS24365 | Protein ID | WP_002886901.1 |
Coordinates | 4912938..4913180 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE847_RS24335 (NE847_24335) | 4908148..4908411 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NE847_RS24340 (NE847_24340) | 4908541..4908714 | + | 174 | WP_002886906.1 | hypothetical protein | - |
NE847_RS24345 (NE847_24345) | 4908717..4909460 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NE847_RS24350 (NE847_24350) | 4909817..4911955 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NE847_RS24355 (NE847_24355) | 4912196..4912660 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NE847_RS24360 (NE847_24360) | 4912664..4912948 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NE847_RS24365 (NE847_24365) | 4912938..4913180 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NE847_RS24370 (NE847_24370) | 4913258..4915168 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NE847_RS24375 (NE847_24375) | 4915191..4916345 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NE847_RS24380 (NE847_24380) | 4916411..4917151 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T248896 WP_002886902.1 NZ_CP099413:c4912948-4912664 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |