Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4196681..4197300 Replicon chromosome
Accession NZ_CP099413
Organism Klebsiella pneumoniae strain 33367

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NE847_RS20920 Protein ID WP_002892050.1
Coordinates 4197082..4197300 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NE847_RS20915 Protein ID WP_002892066.1
Coordinates 4196681..4197055 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE847_RS20905 (NE847_20905) 4191833..4193026 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NE847_RS20910 (NE847_20910) 4193049..4196195 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NE847_RS20915 (NE847_20915) 4196681..4197055 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NE847_RS20920 (NE847_20920) 4197082..4197300 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NE847_RS20925 (NE847_20925) 4197459..4198025 + 567 WP_002892030.1 maltose O-acetyltransferase -
NE847_RS20930 (NE847_20930) 4197997..4198137 - 141 WP_004147370.1 hypothetical protein -
NE847_RS20935 (NE847_20935) 4198158..4198628 + 471 WP_002892026.1 YlaC family protein -
NE847_RS20940 (NE847_20940) 4198603..4200054 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NE847_RS20945 (NE847_20945) 4200155..4200853 + 699 WP_002892021.1 GNAT family protein -
NE847_RS20950 (NE847_20950) 4200850..4200990 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NE847_RS20955 (NE847_20955) 4200990..4201253 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T248894 WP_002892050.1 NZ_CP099413:4197082-4197300 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT248894 WP_002892066.1 NZ_CP099413:4196681-4197055 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References