Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 839972..840570 Replicon plasmid pRsp_Pop5_1
Accession NZ_CP099402
Organism Rhizobium sp. Pop5

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NE852_RS32005 Protein ID WP_258157061.1
Coordinates 839972..840265 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID K0VFN6
Locus tag NE852_RS32010 Protein ID WP_008537324.1
Coordinates 840262..840570 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE852_RS31985 (NE852_31895) 835110..835505 + 396 WP_008532935.1 hypothetical protein -
NE852_RS31990 (NE852_31900) 835666..836004 + 339 WP_008532934.1 DUF2147 domain-containing protein -
NE852_RS31995 (NE852_31905) 836067..837248 - 1182 WP_008532933.1 Fic family protein -
NE852_RS32000 (NE852_31910) 837495..839861 + 2367 WP_205621978.1 hypothetical protein -
NE852_RS32005 (NE852_31915) 839972..840265 - 294 WP_258157061.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE852_RS32010 (NE852_31920) 840262..840570 - 309 WP_008537324.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NE852_RS32015 (NE852_31925) 840772..841404 - 633 Protein_781 DeoR/GlpR family DNA-binding transcription regulator -
NE852_RS32020 (NE852_31930) 841406..841936 - 531 Protein_782 ATP-binding protein -
NE852_RS32025 (NE852_31935) 842053..842432 - 380 Protein_783 DUF2255 family protein -
NE852_RS32030 (NE852_31940) 842929..843123 + 195 WP_008532923.1 type II toxin-antitoxin system VapB family antitoxin -
NE852_RS32035 (NE852_31945) 843123..843536 + 414 WP_037174276.1 type II toxin-antitoxin system VapC family toxin -
NE852_RS32040 (NE852_31950) 843788..844372 + 585 Protein_786 IS110 family transposase -
NE852_RS32045 (NE852_31955) 844530..844741 + 212 Protein_787 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB / htpB 1..951562 951562
- flank IS/Tn - - 841271..841936 665


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-58)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10629.13 Da        Isoelectric Point: 5.7996

>T248884 WP_258157061.1 NZ_CP099402:c840265-839972 [Rhizobium sp. Pop5]
VKLTWSAFVLSDRDAIFTYIEAENPSAAILVDERIAAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG

Download         Length: 294 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11012.35 Da        Isoelectric Point: 5.1570

>AT248884 WP_008537324.1 NZ_CP099402:c840570-840262 [Rhizobium sp. Pop5]
MAANALVQTRIDAEIRDRASAVLGNMGLTVSDAVRILLTRTANEGALPLELLSGSEAHDAWFRAKVLEALNDTRPDVSDD
EVETHFAERRAAARLNAGARKS

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB K0VFN6

References