Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 839972..840570 | Replicon | plasmid pRsp_Pop5_1 |
Accession | NZ_CP099402 | ||
Organism | Rhizobium sp. Pop5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NE852_RS32005 | Protein ID | WP_258157061.1 |
Coordinates | 839972..840265 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | K0VFN6 |
Locus tag | NE852_RS32010 | Protein ID | WP_008537324.1 |
Coordinates | 840262..840570 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE852_RS31985 (NE852_31895) | 835110..835505 | + | 396 | WP_008532935.1 | hypothetical protein | - |
NE852_RS31990 (NE852_31900) | 835666..836004 | + | 339 | WP_008532934.1 | DUF2147 domain-containing protein | - |
NE852_RS31995 (NE852_31905) | 836067..837248 | - | 1182 | WP_008532933.1 | Fic family protein | - |
NE852_RS32000 (NE852_31910) | 837495..839861 | + | 2367 | WP_205621978.1 | hypothetical protein | - |
NE852_RS32005 (NE852_31915) | 839972..840265 | - | 294 | WP_258157061.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NE852_RS32010 (NE852_31920) | 840262..840570 | - | 309 | WP_008537324.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NE852_RS32015 (NE852_31925) | 840772..841404 | - | 633 | Protein_781 | DeoR/GlpR family DNA-binding transcription regulator | - |
NE852_RS32020 (NE852_31930) | 841406..841936 | - | 531 | Protein_782 | ATP-binding protein | - |
NE852_RS32025 (NE852_31935) | 842053..842432 | - | 380 | Protein_783 | DUF2255 family protein | - |
NE852_RS32030 (NE852_31940) | 842929..843123 | + | 195 | WP_008532923.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NE852_RS32035 (NE852_31945) | 843123..843536 | + | 414 | WP_037174276.1 | type II toxin-antitoxin system VapC family toxin | - |
NE852_RS32040 (NE852_31950) | 843788..844372 | + | 585 | Protein_786 | IS110 family transposase | - |
NE852_RS32045 (NE852_31955) | 844530..844741 | + | 212 | Protein_787 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..951562 | 951562 | |
- | flank | IS/Tn | - | - | 841271..841936 | 665 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10629.13 Da Isoelectric Point: 5.7996
>T248884 WP_258157061.1 NZ_CP099402:c840265-839972 [Rhizobium sp. Pop5]
VKLTWSAFVLSDRDAIFTYIEAENPSAAILVDERIAAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG
VKLTWSAFVLSDRDAIFTYIEAENPSAAILVDERIAAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|