Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 687160..687758 | Replicon | plasmid pRsp_Pop5_1 |
Accession | NZ_CP099402 | ||
Organism | Rhizobium sp. Pop5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NE852_RS31240 | Protein ID | WP_258157024.1 |
Coordinates | 687160..687453 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | K0VFN6 |
Locus tag | NE852_RS31245 | Protein ID | WP_008537324.1 |
Coordinates | 687450..687758 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE852_RS31220 (NE852_31130) | 682648..683580 | + | 933 | WP_008523369.1 | FAD-binding protein | - |
NE852_RS31225 (NE852_31135) | 683634..684542 | + | 909 | WP_008523371.1 | alpha/beta hydrolase | - |
NE852_RS31230 | 685773..685904 | + | 132 | Protein_624 | hypothetical protein | - |
NE852_RS31235 (NE852_31145) | 686292..686972 | + | 681 | WP_258157201.1 | methyl-accepting chemotaxis protein | - |
NE852_RS31240 (NE852_31150) | 687160..687453 | - | 294 | WP_258157024.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NE852_RS31245 (NE852_31155) | 687450..687758 | - | 309 | WP_008537324.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NE852_RS31250 (NE852_31160) | 687967..689919 | - | 1953 | WP_258157025.1 | acetate--CoA ligase | - |
NE852_RS31255 (NE852_31165) | 690077..691411 | - | 1335 | WP_008523382.1 | FAD-binding oxidoreductase | - |
NE852_RS31260 (NE852_31170) | 691587..692465 | - | 879 | WP_037170748.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..951562 | 951562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10615.10 Da Isoelectric Point: 5.7996
>T248883 WP_258157024.1 NZ_CP099402:c687453-687160 [Rhizobium sp. Pop5]
VKLTWSAFALSDRDAIFTYIEGENPSAAILVDERIVAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG
VKLTWSAFALSDRDAIFTYIEGENPSAAILVDERIVAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|