Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 663759..664339 | Replicon | plasmid pRsp_Pop5_1 |
Accession | NZ_CP099402 | ||
Organism | Rhizobium sp. Pop5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | K0WHJ4 |
Locus tag | NE852_RS31125 | Protein ID | WP_008523320.1 |
Coordinates | 663956..664339 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NE852_RS31120 | Protein ID | WP_258157020.1 |
Coordinates | 663759..663959 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE852_RS31110 (NE852_31020) | 659205..661040 | - | 1836 | WP_008523293.1 | HAMP domain-containing methyl-accepting chemotaxis protein | - |
NE852_RS31115 (NE852_31025) | 661512..662810 | - | 1299 | WP_258157018.1 | Nramp family divalent metal transporter | - |
NE852_RS31120 (NE852_31030) | 663759..663959 | + | 201 | WP_258157020.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NE852_RS31125 (NE852_31035) | 663956..664339 | + | 384 | WP_008523320.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NE852_RS31130 (NE852_31040) | 664481..665110 | - | 630 | WP_008523322.1 | CoA transferase subunit B | - |
NE852_RS31135 (NE852_31045) | 665111..665815 | - | 705 | WP_008523324.1 | CoA transferase subunit A | - |
NE852_RS31140 (NE852_31050) | 665935..667071 | - | 1137 | WP_128623493.1 | saccharopine dehydrogenase NADP-binding domain-containing protein | - |
NE852_RS31145 (NE852_31055) | 667247..668260 | + | 1014 | WP_037170731.1 | 3-keto-5-aminohexanoate cleavage protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..951562 | 951562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14214.28 Da Isoelectric Point: 6.6041
>T248882 WP_008523320.1 NZ_CP099402:663956-664339 [Rhizobium sp. Pop5]
VILADTSIWIDHFRHADSELRRIIEDDRLLCHPAVIGELALGGLRDRSSVIAFLAAQREAFVATHDEVMMMIDRHSIFSM
GIGYTDAHLMASVLLDQRAALWTRDKRLRAAAEKAGASLHTPDNPRN
VILADTSIWIDHFRHADSELRRIIEDDRLLCHPAVIGELALGGLRDRSSVIAFLAAQREAFVATHDEVMMMIDRHSIFSM
GIGYTDAHLMASVLLDQRAALWTRDKRLRAAAEKAGASLHTPDNPRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|