Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 424738..425294 | Replicon | plasmid pRsp_Pop5_1 |
| Accession | NZ_CP099402 | ||
| Organism | Rhizobium sp. Pop5 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | K0W5Z5 |
| Locus tag | NE852_RS30005 | Protein ID | WP_008532066.1 |
| Coordinates | 424738..425028 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | K0VVD3 |
| Locus tag | NE852_RS30010 | Protein ID | WP_008532065.1 |
| Coordinates | 425016..425294 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE852_RS29985 (NE852_29900) | 420526..421482 | - | 957 | WP_128623606.1 | AraC family transcriptional regulator | - |
| NE852_RS29990 (NE852_29905) | 421628..422902 | - | 1275 | WP_258157182.1 | D-amino acid dehydrogenase | - |
| NE852_RS29995 (NE852_29910) | 422933..424063 | - | 1131 | WP_008532068.1 | alanine racemase | - |
| NE852_RS30000 (NE852_29915) | 424188..424652 | + | 465 | WP_008532067.1 | Lrp/AsnC family transcriptional regulator | - |
| NE852_RS30005 (NE852_29920) | 424738..425028 | - | 291 | WP_008532066.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NE852_RS30010 (NE852_29925) | 425016..425294 | - | 279 | WP_008532065.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| NE852_RS30015 (NE852_29930) | 425421..426143 | - | 723 | WP_258157183.1 | LuxR family transcriptional regulator | - |
| NE852_RS30020 (NE852_29935) | 426346..426996 | - | 651 | WP_037173719.1 | acyl-homoserine-lactone synthase | - |
| NE852_RS30025 (NE852_29940) | 427178..427522 | + | 345 | WP_008532056.1 | helix-turn-helix domain-containing protein | - |
| NE852_RS30030 (NE852_29945) | 427699..428370 | + | 672 | WP_037173716.1 | hypothetical protein | - |
| NE852_RS30035 (NE852_29950) | 428389..429204 | + | 816 | WP_245270643.1 | hypothetical protein | - |
| NE852_RS30040 (NE852_29955) | 429422..429580 | + | 159 | WP_164841444.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..951562 | 951562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10938.55 Da Isoelectric Point: 7.2028
>T248881 WP_008532066.1 NZ_CP099402:c425028-424738 [Rhizobium sp. Pop5]
MPQVIFSPAAIRDLERLREFLRPKNPSAAKRAGETILKSVRALGMNPYMGRLVEDLPEQYREWLIDFGDSGDVVRYHIDG
DALTILAVRHQRDAGF
MPQVIFSPAAIRDLERLREFLRPKNPSAAKRAGETILKSVRALGMNPYMGRLVEDLPEQYREWLIDFGDSGDVVRYHIDG
DALTILAVRHQRDAGF
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|