Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 134737..135335 Replicon plasmid pRsp_Pop5_2
Accession NZ_CP099401
Organism Rhizobium sp. Pop5

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NE852_RS26345 Protein ID WP_258156931.1
Coordinates 135042..135335 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID K0VFN6
Locus tag NE852_RS26340 Protein ID WP_008537324.1
Coordinates 134737..135045 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE852_RS26310 (NE852_26235) 130430..131071 - 642 WP_008530367.1 DUF47 domain-containing protein -
NE852_RS26315 (NE852_26240) 131237..131422 + 186 Protein_117 hypothetical protein -
NE852_RS26320 (NE852_26245) 131444..132484 - 1041 Protein_118 DNA polymerase IV -
NE852_RS26325 (NE852_26250) 132631..133008 + 378 WP_008530369.1 hypothetical protein -
NE852_RS26330 (NE852_26255) 133001..133522 + 522 WP_008530370.1 hypothetical protein -
NE852_RS26335 (NE852_26260) 133519..134403 + 885 WP_258156930.1 RNA polymerase sigma factor SigJ -
NE852_RS26340 (NE852_26265) 134737..135045 + 309 WP_008537324.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NE852_RS26345 (NE852_26270) 135042..135335 + 294 WP_258156931.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE852_RS26350 (NE852_26275) 135438..135848 - 411 WP_258156932.1 LysR substrate-binding domain-containing protein -
NE852_RS26355 (NE852_26280) 135857..136315 - 459 WP_258156933.1 LysR family transcriptional regulator -
NE852_RS26360 (NE852_26285) 136619..137881 + 1263 WP_037172782.1 ribulose-bisphosphate carboxylase large subunit family protein -
NE852_RS26365 (NE852_26290) 137878..139245 + 1368 WP_008530378.1 four-carbon acid sugar kinase family protein -
NE852_RS26370 (NE852_26295) 139328..140098 + 771 WP_008530383.1 3-oxoacyl-ACP reductase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - gmd 1..503518 503518


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-58)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10585.07 Da        Isoelectric Point: 5.7996

>T248878 WP_258156931.1 NZ_CP099401:135042-135335 [Rhizobium sp. Pop5]
VKLTWSAFALSDRDAIFTYIEAENPAAAILVDERIAAAVRRLIDFPASGRVGRIAGTRELVINGTPYVAAYSFNETAVRI
LRVLHGAQEWPDTLPTG

Download         Length: 294 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11012.35 Da        Isoelectric Point: 5.1570

>AT248878 WP_008537324.1 NZ_CP099401:134737-135045 [Rhizobium sp. Pop5]
MAANALVQTRIDAEIRDRASAVLGNMGLTVSDAVRILLTRTANEGALPLELLSGSEAHDAWFRAKVLEALNDTRPDVSDD
EVETHFAERRAAARLNAGARKS

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB K0VFN6

References