Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 559960..560678 | Replicon | chromosome |
Accession | NZ_CP099399 | ||
Organism | Rhizobium sp. Pop5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | K0VNE9 |
Locus tag | NE852_RS04875 | Protein ID | WP_008529505.1 |
Coordinates | 559960..560418 (-) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | K0VS40 |
Locus tag | NE852_RS04880 | Protein ID | WP_008529504.1 |
Coordinates | 560415..560678 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE852_RS04850 (NE852_04830) | 555160..555582 | + | 423 | WP_128623565.1 | DUF4279 domain-containing protein | - |
NE852_RS04855 (NE852_04835) | 555753..557390 | - | 1638 | WP_008529514.1 | chaperonin GroEL | - |
NE852_RS04860 (NE852_04840) | 557462..557758 | - | 297 | WP_004675403.1 | co-chaperone GroES | - |
NE852_RS04865 (NE852_04845) | 558087..558935 | + | 849 | WP_008529507.1 | TIGR01459 family HAD-type hydrolase | - |
NE852_RS04870 (NE852_04850) | 558950..559933 | + | 984 | WP_008529506.1 | bifunctional riboflavin kinase/FAD synthetase | - |
NE852_RS04875 (NE852_04855) | 559960..560418 | - | 459 | WP_008529505.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NE852_RS04880 (NE852_04860) | 560415..560678 | - | 264 | WP_008529504.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NE852_RS04885 (NE852_04865) | 561033..563939 | + | 2907 | WP_008529503.1 | isoleucine--tRNA ligase | - |
NE852_RS04890 (NE852_04870) | 564071..564700 | + | 630 | WP_008529502.1 | hypothetical protein | - |
NE852_RS04895 (NE852_04875) | 564749..565186 | - | 438 | WP_037172284.1 | nucleoside deaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17163.43 Da Isoelectric Point: 6.7307
>T248877 WP_008529505.1 NZ_CP099399:c560418-559960 [Rhizobium sp. Pop5]
VIGWLLDTNVIAALINPNGAPSVKSWAAAQDEEQMFISVLTLAEYDKGIENLPEDDQNRYRYIAARDALEERFSQRILSL
SDKAVRHWGSVSGRVKLRTGHTPPVIDTMLAVTAIEHNLYLATRNVKDKRFSGAAVFDPWTNDPDQFPLRRK
VIGWLLDTNVIAALINPNGAPSVKSWAAAQDEEQMFISVLTLAEYDKGIENLPEDDQNRYRYIAARDALEERFSQRILSL
SDKAVRHWGSVSGRVKLRTGHTPPVIDTMLAVTAIEHNLYLATRNVKDKRFSGAAVFDPWTNDPDQFPLRRK
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|