Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-StbC |
Location | 4253103..4253764 | Replicon | chromosome |
Accession | NZ_CP099397 | ||
Organism | Pseudomonas hydrolytica strain DSWY01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L1F06_RS19960 | Protein ID | WP_129481803.1 |
Coordinates | 4253345..4253764 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8I0VLZ4 |
Locus tag | L1F06_RS19955 | Protein ID | WP_011921115.1 |
Coordinates | 4253103..4253348 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L1F06_RS19930 (L1F06_019930) | 4248645..4249394 | + | 750 | WP_252576688.1 | hypothetical protein | - |
L1F06_RS19935 (L1F06_019935) | 4249400..4249759 | + | 360 | WP_129481800.1 | DUF2523 family protein | - |
L1F06_RS19940 (L1F06_019940) | 4249762..4251087 | + | 1326 | WP_129481801.1 | zonular occludens toxin domain-containing protein | - |
L1F06_RS19945 (L1F06_019945) | 4251000..4252058 | + | 1059 | Protein_3934 | hypothetical protein | - |
L1F06_RS19950 (L1F06_019950) | 4252055..4253050 | + | 996 | WP_129481802.1 | tyrosine-type recombinase/integrase | - |
L1F06_RS19955 (L1F06_019955) | 4253103..4253348 | + | 246 | WP_011921115.1 | Arc family DNA-binding protein | Antitoxin |
L1F06_RS19960 (L1F06_019960) | 4253345..4253764 | + | 420 | WP_129481803.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L1F06_RS19970 (L1F06_019970) | 4254159..4254386 | + | 228 | WP_003244658.1 | hypothetical protein | - |
L1F06_RS19975 (L1F06_019975) | 4254383..4254736 | - | 354 | WP_129481804.1 | excalibur calcium-binding domain-containing protein | - |
L1F06_RS19980 (L1F06_019980) | 4254875..4255039 | + | 165 | WP_096825672.1 | hypothetical protein | - |
L1F06_RS19985 (L1F06_019985) | 4255066..4255512 | + | 447 | WP_129481805.1 | hypothetical protein | - |
L1F06_RS19990 (L1F06_019990) | 4255521..4256099 | - | 579 | WP_003244654.1 | hypothetical protein | - |
L1F06_RS19995 (L1F06_019995) | 4256201..4257112 | - | 912 | WP_011921109.1 | DMT family transporter | - |
L1F06_RS20000 (L1F06_020000) | 4257449..4258156 | - | 708 | WP_129481806.1 | DNA/RNA nuclease SfsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4235191..4257112 | 21921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15067.30 Da Isoelectric Point: 4.2947
>T248876 WP_129481803.1 NZ_CP099397:4253345-4253764 [Pseudomonas hydrolytica]
MILLDTNVLSELMRAKPAPQVLEWVDAQPVGDLVITSITVAEILYGIARMPDGKRKQGLLDVASVMFDEDFAGNILPFDA
DAAVHYAEIAAETEAKGRVVDMADAQIAAIGRLHDAVIATRNIRHFETLGVALVDPWSN
MILLDTNVLSELMRAKPAPQVLEWVDAQPVGDLVITSITVAEILYGIARMPDGKRKQGLLDVASVMFDEDFAGNILPFDA
DAAVHYAEIAAETEAKGRVVDMADAQIAAIGRLHDAVIATRNIRHFETLGVALVDPWSN
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|