Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2502823..2503388 | Replicon | chromosome |
Accession | NZ_CP099396 | ||
Organism | Lacticaseibacillus rhamnosus strain P118 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | NFI97_RS11565 | Protein ID | WP_005692155.1 |
Coordinates | 2502823..2503170 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NFI97_RS11570 | Protein ID | WP_020752297.1 |
Coordinates | 2503170..2503388 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFI97_RS11545 | 2498318..2499559 | - | 1242 | WP_005692160.1 | acyltransferase | - |
NFI97_RS11550 | 2499556..2500257 | - | 702 | WP_005692159.1 | ATP-binding cassette domain-containing protein | - |
NFI97_RS11555 | 2500250..2501068 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
NFI97_RS11560 | 2501309..2501977 | - | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
NFI97_RS11565 | 2502823..2503170 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFI97_RS11570 | 2503170..2503388 | - | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
NFI97_RS11575 | 2503482..2505317 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
NFI97_RS11580 | 2505304..2507094 | - | 1791 | WP_015764722.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T248871 WP_005692155.1 NZ_CP099396:c2503170-2502823 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|