Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4455487..4456073 | Replicon | chromosome |
Accession | NZ_CP099394 | ||
Organism | Paraburkholderia bryophila strain CA002 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NDK50_RS20210 | Protein ID | WP_111933386.1 |
Coordinates | 4455487..4455669 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NDK50_RS20215 | Protein ID | WP_272625783.1 |
Coordinates | 4455666..4456073 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDK50_RS20185 (NDK50_20170) | 4451203..4451628 | - | 426 | WP_012434707.1 | flagellar basal body rod protein FlgC | - |
NDK50_RS20190 (NDK50_20175) | 4451724..4452218 | - | 495 | WP_111933390.1 | flagellar basal body rod protein FlgB | - |
NDK50_RS20195 (NDK50_20180) | 4452437..4454062 | + | 1626 | WP_272625777.1 | flagellar basal body P-ring formation chaperone FlgA | - |
NDK50_RS20200 (NDK50_20185) | 4454264..4454620 | + | 357 | WP_272625779.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
NDK50_RS20205 (NDK50_20190) | 4454715..4455161 | + | 447 | WP_272625781.1 | flagellar protein FlgN | - |
NDK50_RS20210 (NDK50_20195) | 4455487..4455669 | + | 183 | WP_111933386.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NDK50_RS20215 (NDK50_20200) | 4455666..4456073 | + | 408 | WP_272625783.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NDK50_RS20220 (NDK50_20205) | 4456192..4456926 | - | 735 | WP_111933384.1 | RNA polymerase sigma factor FliA | - |
NDK50_RS20225 (NDK50_20210) | 4456955..4457824 | - | 870 | WP_272625786.1 | AAA family ATPase | - |
NDK50_RS20230 (NDK50_20215) | 4457817..4459808 | - | 1992 | WP_272625787.1 | flagellar biosynthesis protein FlhF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6747.90 Da Isoelectric Point: 11.7767
>T248868 WP_111933386.1 NZ_CP099394:4455487-4455669 [Paraburkholderia bryophila]
MNSAAVMKWIQANDWQLVRISGSHHHFRHPFRAGLVTIPHPKKDLPPGTLNSILKQAGLK
MNSAAVMKWIQANDWQLVRISGSHHHFRHPFRAGLVTIPHPKKDLPPGTLNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14722.86 Da Isoelectric Point: 4.7078
>AT248868 WP_272625783.1 NZ_CP099394:4455666-4456073 [Paraburkholderia bryophila]
MKNLIFPIALESGDDQHAYGVVVPDLPGCFAAGDTLEEAFANAKLAVESHLDTLLDEGLPVPQPLKLSEHRRNPDYAGFI
WGFVVTRNIPALKKAVRINISLPEVLVQDIDIYAQTRGLSRSSFLALAAEHEMAA
MKNLIFPIALESGDDQHAYGVVVPDLPGCFAAGDTLEEAFANAKLAVESHLDTLLDEGLPVPQPLKLSEHRRNPDYAGFI
WGFVVTRNIPALKKAVRINISLPEVLVQDIDIYAQTRGLSRSSFLALAAEHEMAA
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|