Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT_toxin-BrnA |
Location | 4404072..4404650 | Replicon | chromosome |
Accession | NZ_CP099394 | ||
Organism | Paraburkholderia bryophila strain CA002 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | NDK50_RS19965 | Protein ID | WP_272625700.1 |
Coordinates | 4404372..4404650 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | NDK50_RS19960 | Protein ID | WP_272625698.1 |
Coordinates | 4404072..4404332 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDK50_RS19940 (NDK50_19925) | 4399163..4399915 | + | 753 | WP_272625691.1 | 5-oxoprolinase subunit PxpA | - |
NDK50_RS19945 (NDK50_19930) | 4400233..4400982 | + | 750 | WP_111933434.1 | DUF969 domain-containing protein | - |
NDK50_RS19950 (NDK50_19935) | 4400979..4401935 | + | 957 | WP_272625694.1 | DUF979 domain-containing protein | - |
NDK50_RS19955 (NDK50_19940) | 4402164..4403978 | + | 1815 | WP_272625696.1 | tetratricopeptide repeat protein | - |
NDK50_RS19960 (NDK50_19945) | 4404072..4404332 | - | 261 | WP_272625698.1 | BrnA antitoxin family protein | Antitoxin |
NDK50_RS19965 (NDK50_19950) | 4404372..4404650 | - | 279 | WP_272625700.1 | BrnT family toxin | Toxin |
NDK50_RS19970 (NDK50_19955) | 4404854..4406029 | - | 1176 | WP_272625702.1 | TraB/GumN family protein | - |
NDK50_RS19975 (NDK50_19960) | 4406022..4407041 | - | 1020 | WP_272625704.1 | peptide ABC transporter ATP-binding protein | - |
NDK50_RS19980 (NDK50_19965) | 4407038..4408042 | - | 1005 | WP_272625706.1 | ABC transporter ATP-binding protein | - |
NDK50_RS19985 (NDK50_19970) | 4408044..4408961 | - | 918 | WP_272625708.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10922.43 Da Isoelectric Point: 6.2241
>T248867 WP_272625700.1 NZ_CP099394:c4404650-4404372 [Paraburkholderia bryophila]
VLFEWDEIKNQINIRKHGIDFSDAIDVFNHPVLTALDQREDYGEERWIALGCISVVLGVVVYVERDENVLRIISARKATR
REITQYRQRVWH
VLFEWDEIKNQINIRKHGIDFSDAIDVFNHPVLTALDQREDYGEERWIALGCISVVLGVVVYVERDENVLRIISARKATR
REITQYRQRVWH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|