Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 1767697..1768376 Replicon chromosome
Accession NZ_CP099394
Organism Paraburkholderia bryophila strain CA002

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NDK50_RS07790 Protein ID WP_272629431.1
Coordinates 1767697..1767882 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NDK50_RS07795 Protein ID WP_272630220.1
Coordinates 1767957..1768376 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDK50_RS07755 (NDK50_07745) 1763378..1764211 + 834 WP_111929955.1 aliphatic sulfonate ABC transporter permease SsuC -
NDK50_RS07760 (NDK50_07750) 1764211..1765335 + 1125 WP_272630219.1 ATP-binding cassette domain-containing protein -
NDK50_RS07765 (NDK50_07755) 1765393..1765608 + 216 WP_011488137.1 molybdopterin-binding protein -
NDK50_RS07770 (NDK50_07760) 1765644..1766090 - 447 WP_272630424.1 hypothetical protein -
NDK50_RS07775 (NDK50_07765) 1766262..1766459 + 198 WP_272629428.1 hypothetical protein -
NDK50_RS07780 (NDK50_07770) 1766588..1766830 + 243 WP_272629429.1 hypothetical protein -
NDK50_RS07785 (NDK50_07775) 1766994..1767260 - 267 WP_111929959.1 hypothetical protein -
NDK50_RS07790 (NDK50_07780) 1767697..1767882 + 186 WP_272629431.1 type II toxin-antitoxin system HicA family toxin Toxin
NDK50_RS07795 (NDK50_07785) 1767957..1768376 + 420 WP_272630220.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDK50_RS07800 (NDK50_07790) 1769118..1769369 + 252 WP_272629433.1 hypothetical protein -
NDK50_RS07805 (NDK50_07795) 1769665..1769922 + 258 WP_272629435.1 hypothetical protein -
NDK50_RS07810 (NDK50_07800) 1770235..1770822 - 588 WP_272629437.1 lipase -
NDK50_RS07815 (NDK50_07805) 1770819..1771283 - 465 WP_272629439.1 hypothetical protein -
NDK50_RS07820 (NDK50_07810) 1771319..1771531 - 213 WP_272629441.1 hypothetical protein -
NDK50_RS07825 (NDK50_07815) 1771534..1771893 - 360 WP_272629442.1 HNH endonuclease signature motif containing protein -
NDK50_RS07830 (NDK50_07820) 1771952..1772503 - 552 WP_272629443.1 glycoside hydrolase family 19 protein -
NDK50_RS07835 (NDK50_07825) 1772500..1772877 - 378 WP_272629445.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1765644..1852660 87016


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-63)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7128.17 Da        Isoelectric Point: 10.9929

>T248865 WP_272629431.1 NZ_CP099394:1767697-1767882 [Paraburkholderia bryophila]
MKYSEFRKWLRKQGATFERHRSGSIHYRVTLNGKTTIFPDHGAREMGTHLVEAIKNQLGIQ

Download         Length: 186 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15485.94 Da        Isoelectric Point: 5.7791

>AT248865 WP_272630220.1 NZ_CP099394:1767957-1768376 [Paraburkholderia bryophila]
MLSYPIELTPDSNGTLLVTFADVPEALSVGENEEDAIAQALDALEAALEIYFSEKQPIPLPSRPKRGQHVVTLPALVTSK
VLLANEMLQQNVRKAELARRLKVNQVQVDRLLNFRHSSKIEMVESAFAVLGRRLEVRLV

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References