Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4967448..4968064 Replicon chromosome
Accession NZ_CP099390
Organism Citrobacter braakii strain RHB02-E3-C05

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ22_RS24140 Protein ID WP_016155182.1
Coordinates 4967448..4967822 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ22_RS24145 Protein ID WP_016155181.1
Coordinates 4967822..4968064 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ22_RS24125 (NFJ22_24125) 4964951..4965853 + 903 WP_016155183.1 formate dehydrogenase O subunit beta -
NFJ22_RS24130 (NFJ22_24130) 4965850..4966485 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ22_RS24135 (NFJ22_24135) 4966482..4967411 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ22_RS24140 (NFJ22_24140) 4967448..4967822 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ22_RS24145 (NFJ22_24145) 4967822..4968064 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ22_RS24150 (NFJ22_24150) 4968269..4969198 + 930 WP_047497507.1 alpha/beta hydrolase -
NFJ22_RS24155 (NFJ22_24155) 4969283..4969594 + 312 WP_279263645.1 type II toxin-antitoxin system HigB family toxin -
NFJ22_RS24160 (NFJ22_24160) 4969591..4970043 + 453 WP_080859878.1 helix-turn-helix domain-containing protein -
NFJ22_RS24165 (NFJ22_24165) 4970061..4971002 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ22_RS24170 (NFJ22_24170) 4971047..4971484 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFJ22_RS24175 (NFJ22_24175) 4971481..4972353 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ22_RS24180 (NFJ22_24180) 4972347..4972946 - 600 WP_279263646.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248863 WP_016155182.1 NZ_CP099390:c4967822-4967448 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248863 WP_016155181.1 NZ_CP099390:c4968064-4967822 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References