Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4653816..4654601 | Replicon | chromosome |
| Accession | NZ_CP099390 | ||
| Organism | Citrobacter braakii strain RHB02-E3-C05 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFJ22_RS22765 | Protein ID | WP_236874429.1 |
| Coordinates | 4654224..4654601 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFJ22_RS22760 | Protein ID | WP_236874428.1 |
| Coordinates | 4653816..4654172 (+) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ22_RS22710 (NFJ22_22705) | 4648998..4649285 | + | 288 | WP_236874418.1 | hypothetical protein | - |
| NFJ22_RS22715 (NFJ22_22710) | 4649298..4649609 | + | 312 | WP_279263614.1 | hypothetical protein | - |
| NFJ22_RS22720 (NFJ22_22715) | 4649679..4650146 | + | 468 | WP_236874420.1 | hypothetical protein | - |
| NFJ22_RS22725 (NFJ22_22720) | 4650353..4650586 | + | 234 | WP_236874421.1 | DUF905 family protein | - |
| NFJ22_RS22730 (NFJ22_22725) | 4650696..4651514 | + | 819 | WP_236874422.1 | DUF932 domain-containing protein | - |
| NFJ22_RS22735 (NFJ22_22730) | 4651533..4651742 | + | 210 | WP_236874423.1 | hypothetical protein | - |
| NFJ22_RS22740 (NFJ22_22735) | 4651870..4652334 | + | 465 | WP_236874424.1 | antirestriction protein | - |
| NFJ22_RS22745 (NFJ22_22740) | 4652346..4652870 | + | 525 | WP_236874425.1 | DNA repair protein RadC | - |
| NFJ22_RS22750 (NFJ22_22745) | 4652884..4653105 | + | 222 | WP_236874426.1 | DUF987 domain-containing protein | - |
| NFJ22_RS22755 (NFJ22_22750) | 4653121..4653765 | + | 645 | WP_236874427.1 | antitoxin of toxin-antitoxin stability system | - |
| NFJ22_RS22760 (NFJ22_22755) | 4653816..4654172 | + | 357 | WP_236874428.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFJ22_RS22765 (NFJ22_22760) | 4654224..4654601 | + | 378 | WP_236874429.1 | TA system toxin CbtA family protein | Toxin |
| NFJ22_RS22770 (NFJ22_22765) | 4654598..4655089 | + | 492 | WP_236874430.1 | DUF5983 family protein | - |
| NFJ22_RS22775 (NFJ22_22770) | 4655218..4656066 | + | 849 | WP_279263615.1 | DUF4942 domain-containing protein | - |
| NFJ22_RS22780 (NFJ22_22775) | 4656579..4656674 | + | 96 | Protein_4468 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14051.95 Da Isoelectric Point: 7.8014
>T248862 WP_236874429.1 NZ_CP099390:4654224-4654601 [Citrobacter braakii]
MQTQPLSSTREASPRPSPVEIWQQVLSHLLDQHYGLTLNDTPFSNDGAIQEHIDAGISLCDAVNFIVEKYELVRIDRHGF
SAETQSPLIGCIDILRARKACGLITRNRYKAVTNITRGKYSKVQQ
MQTQPLSSTREASPRPSPVEIWQQVLSHLLDQHYGLTLNDTPFSNDGAIQEHIDAGISLCDAVNFIVEKYELVRIDRHGF
SAETQSPLIGCIDILRARKACGLITRNRYKAVTNITRGKYSKVQQ
Download Length: 378 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13057.78 Da Isoelectric Point: 5.9517
>AT248862 WP_236874428.1 NZ_CP099390:4653816-4654172 [Citrobacter braakii]
MPDNPATDDNMDAPRWGLQRSITPCFGARLVQEGNRLHYLADRASITGTFSDADLRHLDQAFPVLLKQLELMLVSGELNP
RHQHCVTLYAKGLTCESDTLASHGYVYLAIYPTPATTA
MPDNPATDDNMDAPRWGLQRSITPCFGARLVQEGNRLHYLADRASITGTFSDADLRHLDQAFPVLLKQLELMLVSGELNP
RHQHCVTLYAKGLTCESDTLASHGYVYLAIYPTPATTA
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|