Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 865279..865933 | Replicon | chromosome |
| Accession | NZ_CP099390 | ||
| Organism | Citrobacter braakii strain RHB02-E3-C05 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R8WN60 |
| Locus tag | NFJ22_RS04270 | Protein ID | WP_016154348.1 |
| Coordinates | 865526..865933 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | NFJ22_RS04265 | Protein ID | WP_016154349.1 |
| Coordinates | 865279..865545 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ22_RS04240 (NFJ22_04230) | 860491..861924 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
| NFJ22_RS04245 (NFJ22_04235) | 862046..862774 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| NFJ22_RS04250 (NFJ22_04240) | 862827..863138 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFJ22_RS04255 (NFJ22_04245) | 863302..863961 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
| NFJ22_RS04260 (NFJ22_04250) | 864041..865021 | - | 981 | WP_137352061.1 | tRNA-modifying protein YgfZ | - |
| NFJ22_RS04265 (NFJ22_04255) | 865279..865545 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| NFJ22_RS04270 (NFJ22_04260) | 865526..865933 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
| NFJ22_RS04275 (NFJ22_04265) | 866034..866555 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
| NFJ22_RS04280 (NFJ22_04270) | 866669..867565 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
| NFJ22_RS04285 (NFJ22_04275) | 867589..868302 | + | 714 | WP_103766660.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFJ22_RS04290 (NFJ22_04280) | 868308..870041 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248855 WP_016154348.1 NZ_CP099390:865526-865933 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|