Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4773811..4774427 Replicon chromosome
Accession NZ_CP099389
Organism Citrobacter braakii strain RHB02-E4-C01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ24_RS22595 Protein ID WP_200080372.1
Coordinates 4773811..4774185 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ24_RS22600 Protein ID WP_016155181.1
Coordinates 4774185..4774427 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ24_RS22580 (4771314) 4771314..4772216 + 903 WP_016155183.1 formate dehydrogenase O subunit beta -
NFJ24_RS22585 (4772213) 4772213..4772848 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ24_RS22590 (4772845) 4772845..4773774 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ24_RS22595 (4773811) 4773811..4774185 - 375 WP_200080372.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ24_RS22600 (4774185) 4774185..4774427 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ24_RS22605 (4774632) 4774632..4775561 + 930 WP_047497507.1 alpha/beta hydrolase -
NFJ24_RS22610 (4775646) 4775646..4775957 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ24_RS22615 (4775954) 4775954..4776406 + 453 WP_103767199.1 helix-turn-helix domain-containing protein -
NFJ24_RS22620 (4776424) 4776424..4777365 - 942 WP_049282313.1 fatty acid biosynthesis protein FabY -
NFJ24_RS22625 (4777410) 4777410..4777847 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFJ24_RS22630 (4777844) 4777844..4778716 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ24_RS22635 (4778710) 4778710..4779309 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13625.79 Da        Isoelectric Point: 7.1642

>T248852 WP_200080372.1 NZ_CP099389:c4774185-4773811 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTCNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248852 WP_016155181.1 NZ_CP099389:c4774427-4774185 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References