Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4264128..4264810 | Replicon | chromosome |
Accession | NZ_CP099389 | ||
Organism | Citrobacter braakii strain RHB02-E4-C01 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | NFJ24_RS20270 | Protein ID | WP_114263376.1 |
Coordinates | 4264128..4264469 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NFJ24_RS20275 | Protein ID | WP_114263375.1 |
Coordinates | 4264490..4264810 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ24_RS20240 (4260172) | 4260172..4260534 | + | 363 | WP_235117078.1 | endoribonuclease SymE | - |
NFJ24_RS20245 (4260593) | 4260593..4261078 | - | 486 | WP_094760967.1 | type VI secretion system tube protein TssD | - |
NFJ24_RS20250 (4261098) | 4261098..4261430 | - | 333 | WP_094760968.1 | DUF1493 family protein | - |
NFJ24_RS20255 (4261424) | 4261424..4261879 | - | 456 | WP_235117079.1 | hypothetical protein | - |
NFJ24_RS20260 (4262138) | 4262138..4263010 | + | 873 | WP_279266228.1 | HNH endonuclease | - |
NFJ24_RS20265 (4263349) | 4263349..4263993 | + | 645 | WP_279266229.1 | hypothetical protein | - |
NFJ24_RS20270 (4264128) | 4264128..4264469 | - | 342 | WP_114263376.1 | TA system toxin CbtA family protein | Toxin |
NFJ24_RS20275 (4264490) | 4264490..4264810 | - | 321 | WP_114263375.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ24_RS20280 (4264829) | 4264829..4265050 | - | 222 | WP_279266230.1 | DUF987 domain-containing protein | - |
NFJ24_RS20285 (4265059) | 4265059..4265541 | - | 483 | WP_114263374.1 | DNA repair protein RadC | - |
NFJ24_RS20290 (4265550) | 4265550..4266014 | - | 465 | WP_279266231.1 | antirestriction protein | - |
NFJ24_RS20295 (4266155) | 4266155..4268998 | - | 2844 | WP_279266232.1 | Ag43/Cah family autotransporter adhesin | - |
NFJ24_RS20300 (4269071) | 4269071..4269757 | - | 687 | WP_047738081.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4261098..4297985 | 36887 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12773.84 Da Isoelectric Point: 6.9769
>T248851 WP_114263376.1 NZ_CP099389:c4264469-4264128 [Citrobacter braakii]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEYIDAGISLANAVNFLVEKYELVRIDRRGF
SWQEQSPYLLAVDILQARQAIGLLRRSLNDAVL
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEYIDAGISLANAVNFLVEKYELVRIDRRGF
SWQEQSPYLLAVDILQARQAIGLLRRSLNDAVL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|