Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3666101..3666721 | Replicon | chromosome |
Accession | NZ_CP099389 | ||
Organism | Citrobacter braakii strain RHB02-E4-C01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ24_RS17560 | Protein ID | WP_002892050.1 |
Coordinates | 3666503..3666721 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NFJ24_RS17555 | Protein ID | WP_235116650.1 |
Coordinates | 3666101..3666475 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ24_RS17545 (3661248) | 3661248..3662441 | + | 1194 | WP_053389373.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ24_RS17550 (3662464) | 3662464..3665613 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFJ24_RS17555 (3666101) | 3666101..3666475 | + | 375 | WP_235116650.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ24_RS17560 (3666503) | 3666503..3666721 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ24_RS17565 (3666902) | 3666902..3667453 | + | 552 | WP_016152072.1 | maltose O-acetyltransferase | - |
NFJ24_RS17570 (3667570) | 3667570..3668040 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFJ24_RS17575 (3668119) | 3668119..3668259 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ24_RS17580 (3668261) | 3668261..3668521 | - | 261 | WP_235116651.1 | type B 50S ribosomal protein L31 | - |
NFJ24_RS17585 (3668710) | 3668710..3670263 | + | 1554 | WP_047416867.1 | EAL domain-containing protein | - |
NFJ24_RS17590 (3670315) | 3670315..3670668 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFJ24_RS17595 (3670733) | 3670733..3671362 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248850 WP_002892050.1 NZ_CP099389:3666503-3666721 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1292
>AT248850 WP_235116650.1 NZ_CP099389:3666101-3666475 [Citrobacter braakii]
MDEYSPKRYDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRYDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|