Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2406650..2407286 | Replicon | chromosome |
| Accession | NZ_CP099389 | ||
| Organism | Citrobacter braakii strain RHB02-E4-C01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ24_RS11495 | Protein ID | WP_049259794.1 |
| Coordinates | 2406650..2406838 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ24_RS11500 | Protein ID | WP_131382557.1 |
| Coordinates | 2406870..2407286 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ24_RS11475 (2403427) | 2403427..2403657 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
| NFJ24_RS11480 (2403847) | 2403847..2403972 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ24_RS11485 (2403972) | 2403972..2404982 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ24_RS11490 (2404982) | 2404982..2406385 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ24_RS11495 (2406650) | 2406650..2406838 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ24_RS11500 (2406870) | 2406870..2407286 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ24_RS11505 (2407379) | 2407379..2408788 | + | 1410 | WP_235116830.1 | PLP-dependent aminotransferase family protein | - |
| NFJ24_RS11510 (2409118) | 2409118..2410263 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ24_RS11515 (2410280) | 2410280..2411296 | + | 1017 | WP_153690354.1 | ABC transporter ATP-binding protein | - |
| NFJ24_RS11520 (2411297) | 2411297..2412241 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248845 WP_049259794.1 NZ_CP099389:2406650-2406838 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT248845 WP_131382557.1 NZ_CP099389:2406870-2407286 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|