Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 849125..849779 | Replicon | chromosome |
Accession | NZ_CP099389 | ||
Organism | Citrobacter braakii strain RHB02-E4-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A7L6TYP6 |
Locus tag | NFJ24_RS04125 | Protein ID | WP_047357821.1 |
Coordinates | 849372..849779 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFJ24_RS04120 | Protein ID | WP_016154349.1 |
Coordinates | 849125..849391 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ24_RS04095 (844338) | 844338..845771 | - | 1434 | WP_235117298.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ24_RS04100 (845892) | 845892..846620 | - | 729 | WP_049282170.1 | MurR/RpiR family transcriptional regulator | - |
NFJ24_RS04105 (846673) | 846673..846984 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ24_RS04110 (847148) | 847148..847807 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFJ24_RS04115 (847887) | 847887..848867 | - | 981 | WP_235117299.1 | tRNA-modifying protein YgfZ | - |
NFJ24_RS04120 (849125) | 849125..849391 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFJ24_RS04125 (849372) | 849372..849779 | + | 408 | WP_047357821.1 | protein YgfX | Toxin |
NFJ24_RS04130 (849880) | 849880..850401 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFJ24_RS04135 (850515) | 850515..851411 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFJ24_RS04140 (851435) | 851435..852148 | + | 714 | WP_103766660.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ24_RS04145 (852154) | 852154..853887 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15878.67 Da Isoelectric Point: 11.5023
>T248844 WP_047357821.1 NZ_CP099389:849372-849779 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQARQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQARQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6TYP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WMJ6 |