Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4770975..4771591 Replicon chromosome
Accession NZ_CP099388
Organism Citrobacter braakii strain RHB03-E1-C02

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ30_RS22575 Protein ID WP_016155182.1
Coordinates 4770975..4771349 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ30_RS22580 Protein ID WP_016155181.1
Coordinates 4771349..4771591 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ30_RS22560 (NFJ30_22550) 4768478..4769380 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ30_RS22565 (NFJ30_22555) 4769377..4770012 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ30_RS22570 (NFJ30_22560) 4770009..4770938 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ30_RS22575 (NFJ30_22565) 4770975..4771349 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ30_RS22580 (NFJ30_22570) 4771349..4771591 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ30_RS22585 (NFJ30_22575) 4771797..4772726 + 930 WP_169330465.1 alpha/beta hydrolase -
NFJ30_RS22590 (NFJ30_22580) 4772811..4773122 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ30_RS22595 (NFJ30_22585) 4773119..4773571 + 453 WP_141876133.1 helix-turn-helix domain-containing protein -
NFJ30_RS22600 (NFJ30_22590) 4773589..4774530 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ30_RS22605 (NFJ30_22595) 4774575..4775012 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
NFJ30_RS22610 (NFJ30_22600) 4775009..4775881 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ30_RS22615 (NFJ30_22605) 4775875..4776474 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248841 WP_016155182.1 NZ_CP099388:c4771349-4770975 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248841 WP_016155181.1 NZ_CP099388:c4771591-4771349 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References