Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 4254272..4255047 Replicon chromosome
Accession NZ_CP099388
Organism Citrobacter braakii strain RHB03-E1-C02

Toxin (Protein)


Gene name ypjF Uniprot ID A0A1A9F770
Locus tag NFJ30_RS20215 Protein ID WP_064324662.1
Coordinates 4254272..4254643 (-) Length 124 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFJ30_RS20220 Protein ID WP_169330389.1
Coordinates 4254682..4255047 (-) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ30_RS20190 (NFJ30_20180) 4251151..4251513 + 363 WP_019078284.1 endoribonuclease SymE -
NFJ30_RS20195 (NFJ30_20185) 4251571..4252056 - 486 WP_016151545.1 type VI secretion system tube protein TssD -
NFJ30_RS20200 (NFJ30_20190) 4252075..4252401 - 327 WP_016155588.1 DUF1493 family protein -
NFJ30_RS20205 (NFJ30_20195) 4252395..4252844 - 450 WP_003830103.1 hypothetical protein -
NFJ30_RS20210 (NFJ30_20200) 4253103..4253975 + 873 WP_169330388.1 HNH endonuclease -
NFJ30_RS20215 (NFJ30_20205) 4254272..4254643 - 372 WP_064324662.1 TA system toxin CbtA family protein Toxin
NFJ30_RS20220 (NFJ30_20210) 4254682..4255047 - 366 WP_169330389.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFJ30_RS20225 (NFJ30_20215) 4255073..4255294 - 222 WP_063963757.1 DUF987 family protein -
NFJ30_RS20230 (NFJ30_20220) 4255291..4255833 - 543 WP_169330390.1 DNA repair protein RadC -
NFJ30_RS20235 (NFJ30_20225) 4255846..4256289 - 444 WP_001093282.1 antirestriction protein -
NFJ30_RS20240 (NFJ30_20230) 4256320..4257141 - 822 WP_169330391.1 DUF932 domain-containing protein -
NFJ30_RS20245 (NFJ30_20235) 4257240..4257470 - 231 WP_063925496.1 DUF905 domain-containing protein -
NFJ30_RS20250 (NFJ30_20240) 4257542..4257991 - 450 WP_000734140.1 IrmA family protein -
NFJ30_RS20255 (NFJ30_20245) 4257988..4258440 - 453 WP_000737933.1 hypothetical protein -
NFJ30_RS20260 (NFJ30_20250) 4258477..4259046 - 570 WP_169330504.1 hypothetical protein -
NFJ30_RS20265 (NFJ30_20255) 4259046..4259750 - 705 WP_169330392.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4252075..4276078 24003


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(17-116)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13716.66 Da        Isoelectric Point: 6.4803

>T248840 WP_064324662.1 NZ_CP099388:c4254643-4254272 [Citrobacter braakii]
MQTISSHPTRAAQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFSDEATIQEHIDAGISLSDAVNFLVEKYELVRIDCDGC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGQHQEL

Download         Length: 372 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13408.07 Da        Isoelectric Point: 5.4296

>AT248840 WP_169330389.1 NZ_CP099388:c4255047-4254682 [Citrobacter braakii]
MNNHSESGAILENSPCQQWGLKSTITPCFGARLVQEGDRLHFLADRAGFNGAFSDEHALRLDQAFPLILKQLELMLTSGE
LNPRHPHSVTLYHNGLTCEADTLGSCGYVFIAIYPEHTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A9F770

Antitoxin

Source ID Structure

References