Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2383928..2384564 | Replicon | chromosome |
| Accession | NZ_CP099388 | ||
| Organism | Citrobacter braakii strain RHB03-E1-C02 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ30_RS11320 | Protein ID | WP_049259794.1 |
| Coordinates | 2383928..2384116 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ30_RS11325 | Protein ID | WP_131382557.1 |
| Coordinates | 2384148..2384564 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ30_RS11300 (NFJ30_11290) | 2380706..2380936 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
| NFJ30_RS11305 (NFJ30_11295) | 2381126..2381251 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ30_RS11310 (NFJ30_11300) | 2381251..2382261 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ30_RS11315 (NFJ30_11305) | 2382261..2383664 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ30_RS11320 (NFJ30_11310) | 2383928..2384116 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ30_RS11325 (NFJ30_11315) | 2384148..2384564 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ30_RS11330 (NFJ30_11320) | 2384657..2386066 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
| NFJ30_RS11335 (NFJ30_11325) | 2386396..2387541 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ30_RS11340 (NFJ30_11330) | 2387558..2388574 | + | 1017 | WP_016153153.1 | ABC transporter ATP-binding protein | - |
| NFJ30_RS11345 (NFJ30_11335) | 2388575..2389519 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248834 WP_049259794.1 NZ_CP099388:2383928-2384116 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT248834 WP_131382557.1 NZ_CP099388:2384148-2384564 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|