Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2417908..2418544 | Replicon | chromosome |
| Accession | NZ_CP099387 | ||
| Organism | Citrobacter braakii strain RHB08-E3-C01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ49_RS11745 | Protein ID | WP_049259794.1 |
| Coordinates | 2417908..2418096 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ49_RS11750 | Protein ID | WP_131341011.1 |
| Coordinates | 2418128..2418544 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ49_RS11725 (2414686) | 2414686..2414916 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
| NFJ49_RS11730 (2415106) | 2415106..2415231 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ49_RS11735 (2415231) | 2415231..2416241 | - | 1011 | WP_279273659.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ49_RS11740 (2416241) | 2416241..2417644 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ49_RS11745 (2417908) | 2417908..2418096 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ49_RS11750 (2418128) | 2418128..2418544 | + | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ49_RS11755 (2418637) | 2418637..2420046 | + | 1410 | WP_185654626.1 | PLP-dependent aminotransferase family protein | - |
| NFJ49_RS11760 (2420376) | 2420376..2421521 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ49_RS11765 (2421538) | 2421538..2422554 | + | 1017 | WP_279273660.1 | ABC transporter ATP-binding protein | - |
| NFJ49_RS11770 (2422555) | 2422555..2423499 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248824 WP_049259794.1 NZ_CP099387:2417908-2418096 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248824 WP_131341011.1 NZ_CP099387:2418128-2418544 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|