Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4696009..4696625 | Replicon | chromosome |
| Accession | NZ_CP099386 | ||
| Organism | Citrobacter braakii strain RHB09-E4-C01 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NFJ61_RS22380 | Protein ID | WP_016155182.1 |
| Coordinates | 4696009..4696383 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | R8WIS4 |
| Locus tag | NFJ61_RS22385 | Protein ID | WP_016155181.1 |
| Coordinates | 4696383..4696625 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ61_RS22365 (4693512) | 4693512..4694414 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| NFJ61_RS22370 (4694411) | 4694411..4695046 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ61_RS22375 (4695043) | 4695043..4695972 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ61_RS22380 (4696009) | 4696009..4696383 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ61_RS22385 (4696383) | 4696383..4696625 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
| NFJ61_RS22390 (4696831) | 4696831..4697760 | + | 930 | WP_185655066.1 | alpha/beta hydrolase | - |
| NFJ61_RS22395 (4697845) | 4697845..4698156 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | - |
| NFJ61_RS22400 (4698153) | 4698153..4698605 | + | 453 | WP_279272569.1 | helix-turn-helix domain-containing protein | - |
| NFJ61_RS22405 (4698623) | 4698623..4699564 | - | 942 | WP_185655065.1 | fatty acid biosynthesis protein FabY | - |
| NFJ61_RS22410 (4699609) | 4699609..4700046 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ61_RS22415 (4700043) | 4700043..4700915 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFJ61_RS22420 (4700909) | 4700909..4701508 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13678.84 Da Isoelectric Point: 8.5373
>T248821 WP_016155182.1 NZ_CP099386:c4696383-4696009 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|