Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4696009..4696625 Replicon chromosome
Accession NZ_CP099386
Organism Citrobacter braakii strain RHB09-E4-C01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ61_RS22380 Protein ID WP_016155182.1
Coordinates 4696009..4696383 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ61_RS22385 Protein ID WP_016155181.1
Coordinates 4696383..4696625 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ61_RS22365 (4693512) 4693512..4694414 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ61_RS22370 (4694411) 4694411..4695046 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ61_RS22375 (4695043) 4695043..4695972 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ61_RS22380 (4696009) 4696009..4696383 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ61_RS22385 (4696383) 4696383..4696625 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ61_RS22390 (4696831) 4696831..4697760 + 930 WP_185655066.1 alpha/beta hydrolase -
NFJ61_RS22395 (4697845) 4697845..4698156 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ61_RS22400 (4698153) 4698153..4698605 + 453 WP_279272569.1 helix-turn-helix domain-containing protein -
NFJ61_RS22405 (4698623) 4698623..4699564 - 942 WP_185655065.1 fatty acid biosynthesis protein FabY -
NFJ61_RS22410 (4699609) 4699609..4700046 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
NFJ61_RS22415 (4700043) 4700043..4700915 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ61_RS22420 (4700909) 4700909..4701508 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248821 WP_016155182.1 NZ_CP099386:c4696383-4696009 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248821 WP_016155181.1 NZ_CP099386:c4696625-4696383 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References