Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 4258787..4259306 | Replicon | chromosome |
Accession | NZ_CP099386 | ||
Organism | Citrobacter braakii strain RHB09-E4-C01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFJ61_RS20375 | Protein ID | WP_019078244.1 |
Coordinates | 4258787..4259068 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NFJ61_RS20380 | Protein ID | WP_137380106.1 |
Coordinates | 4259058..4259306 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ61_RS20360 (4255788) | 4255788..4256252 | + | 465 | WP_016151476.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFJ61_RS20365 (4256274) | 4256274..4256795 | - | 522 | WP_279272503.1 | hypothetical protein | - |
NFJ61_RS20370 (4256795) | 4256795..4258759 | - | 1965 | WP_279272504.1 | type VI secretion system tip protein TssI/VgrG | - |
NFJ61_RS20375 (4258787) | 4258787..4259068 | - | 282 | WP_019078244.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ61_RS20380 (4259058) | 4259058..4259306 | - | 249 | WP_137380106.1 | plasmid stabilization protein | Antitoxin |
NFJ61_RS20385 (4259404) | 4259404..4259532 | - | 129 | WP_016155557.1 | hypothetical protein | - |
NFJ61_RS20390 (4259601) | 4259601..4260074 | - | 474 | WP_016155556.1 | hypothetical protein | - |
NFJ61_RS20395 (4260117) | 4260117..4262618 | - | 2502 | WP_279272505.1 | type VI secretion system ATPase TssH | - |
NFJ61_RS20400 (4262609) | 4262609..4263556 | - | 948 | WP_047414725.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10988.76 Da Isoelectric Point: 10.4466
>T248820 WP_019078244.1 NZ_CP099386:c4259068-4258787 [Citrobacter braakii]
MTYNLEFLDIALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDIALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|