Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4164467..4165043 | Replicon | chromosome |
Accession | NZ_CP099386 | ||
Organism | Citrobacter braakii strain RHB09-E4-C01 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A2I8S420 |
Locus tag | NFJ61_RS19960 | Protein ID | WP_049269953.1 |
Coordinates | 4164756..4165043 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
Locus tag | NFJ61_RS19955 | Protein ID | WP_016155614.1 |
Coordinates | 4164467..4164769 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ61_RS19940 (4160963) | 4160963..4161157 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
NFJ61_RS19945 (4161170) | 4161170..4162126 | + | 957 | WP_104651993.1 | GTPase | - |
NFJ61_RS19950 (4162313) | 4162313..4164160 | + | 1848 | WP_016155615.1 | 3'-5' exonuclease | - |
NFJ61_RS19955 (4164467) | 4164467..4164769 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
NFJ61_RS19960 (4164756) | 4164756..4165043 | - | 288 | WP_049269953.1 | BrnT family toxin | Toxin |
NFJ61_RS19965 (4165275) | 4165275..4166441 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
NFJ61_RS19970 (4166537) | 4166537..4166692 | + | 156 | Protein_3910 | type I restriction endonuclease subunit R | - |
NFJ61_RS19975 (4166673) | 4166673..4166905 | + | 233 | Protein_3911 | SymE family type I addiction module toxin | - |
NFJ61_RS19980 (4167036) | 4167036..4167527 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
NFJ61_RS19985 (4167528) | 4167528..4168034 | - | 507 | WP_047414535.1 | hypothetical protein | - |
NFJ61_RS19990 (4168034) | 4168034..4168465 | - | 432 | WP_223952673.1 | DUF2778 domain-containing protein | - |
NFJ61_RS19995 (4168671) | 4168671..4169735 | - | 1065 | WP_049041982.1 | DUF2955 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11433.87 Da Isoelectric Point: 8.6051
>T248819 WP_049269953.1 NZ_CP099386:c4165043-4164756 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESRFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESRFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S420 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S1U6 |