Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3580085..3580705 | Replicon | chromosome |
| Accession | NZ_CP099386 | ||
| Organism | Citrobacter braakii strain RHB09-E4-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFJ61_RS17265 | Protein ID | WP_002892050.1 |
| Coordinates | 3580487..3580705 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
| Locus tag | NFJ61_RS17260 | Protein ID | WP_019076175.1 |
| Coordinates | 3580085..3580459 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ61_RS17250 (3575232) | 3575232..3576425 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ61_RS17255 (3576448) | 3576448..3579597 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
| NFJ61_RS17260 (3580085) | 3580085..3580459 | + | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ61_RS17265 (3580487) | 3580487..3580705 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFJ61_RS17270 (3580886) | 3580886..3581437 | + | 552 | WP_016155874.1 | maltose O-acetyltransferase | - |
| NFJ61_RS17275 (3581554) | 3581554..3582024 | + | 471 | WP_016152071.1 | YlaC family protein | - |
| NFJ61_RS17280 (3582103) | 3582103..3582243 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NFJ61_RS17285 (3582245) | 3582245..3582505 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
| NFJ61_RS17290 (3582694) | 3582694..3584247 | + | 1554 | WP_047416867.1 | EAL domain-containing protein | - |
| NFJ61_RS17295 (3584299) | 3584299..3584652 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| NFJ61_RS17300 (3584717) | 3584717..3585346 | - | 630 | WP_279272413.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248818 WP_002892050.1 NZ_CP099386:3580487-3580705 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT248818 WP_019076175.1 NZ_CP099386:3580085-3580459 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6U5G9 |