Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2348391..2349027 | Replicon | chromosome |
Accession | NZ_CP099386 | ||
Organism | Citrobacter braakii strain RHB09-E4-C01 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
Locus tag | NFJ61_RS11305 | Protein ID | WP_049259794.1 |
Coordinates | 2348391..2348579 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFJ61_RS11310 | Protein ID | WP_131382557.1 |
Coordinates | 2348611..2349027 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ61_RS11285 (2345169) | 2345169..2345399 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
NFJ61_RS11290 (2345589) | 2345589..2345714 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
NFJ61_RS11295 (2345714) | 2345714..2346724 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
NFJ61_RS11300 (2346724) | 2346724..2348127 | - | 1404 | WP_137367004.1 | cytochrome ubiquinol oxidase subunit I | - |
NFJ61_RS11305 (2348391) | 2348391..2348579 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFJ61_RS11310 (2348611) | 2348611..2349027 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFJ61_RS11315 (2349120) | 2349120..2350529 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
NFJ61_RS11320 (2350859) | 2350859..2352004 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
NFJ61_RS11325 (2352021) | 2352021..2353037 | + | 1017 | WP_053389782.1 | ABC transporter ATP-binding protein | - |
NFJ61_RS11330 (2353038) | 2353038..2353982 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248813 WP_049259794.1 NZ_CP099386:2348391-2348579 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT248813 WP_131382557.1 NZ_CP099386:2348611-2349027 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|