Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 799056..799710 | Replicon | chromosome |
Accession | NZ_CP099386 | ||
Organism | Citrobacter braakii strain RHB09-E4-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NFJ61_RS03925 | Protein ID | WP_151222347.1 |
Coordinates | 799303..799710 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFJ61_RS03920 | Protein ID | WP_016154349.1 |
Coordinates | 799056..799322 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ61_RS03895 (794270) | 794270..795703 | - | 1434 | WP_279272683.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ61_RS03900 (795823) | 795823..796551 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFJ61_RS03905 (796604) | 796604..796915 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ61_RS03910 (797079) | 797079..797738 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFJ61_RS03915 (797818) | 797818..798798 | - | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
NFJ61_RS03920 (799056) | 799056..799322 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFJ61_RS03925 (799303) | 799303..799710 | + | 408 | WP_151222347.1 | protein YgfX | Toxin |
NFJ61_RS03930 (799811) | 799811..800332 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFJ61_RS03935 (800446) | 800446..801342 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFJ61_RS03940 (801366) | 801366..802079 | + | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ61_RS03945 (802085) | 802085..803818 | + | 1734 | WP_049269301.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15892.70 Da Isoelectric Point: 11.5023
>T248812 WP_151222347.1 NZ_CP099386:799303-799710 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQARQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQARQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|