Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4835281..4835897 Replicon chromosome
Accession NZ_CP099385
Organism Citrobacter braakii strain RHB09-SO-C07

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ63_RS23180 Protein ID WP_016155182.1
Coordinates 4835281..4835655 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ63_RS23185 Protein ID WP_016155181.1
Coordinates 4835655..4835897 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ63_RS23165 (NFJ63_23165) 4832784..4833686 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ63_RS23170 (NFJ63_23170) 4833683..4834318 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ63_RS23175 (NFJ63_23175) 4834315..4835244 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ63_RS23180 (NFJ63_23180) 4835281..4835655 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ63_RS23185 (NFJ63_23185) 4835655..4835897 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ63_RS23190 (NFJ63_23190) 4836102..4837031 + 930 WP_047497507.1 alpha/beta hydrolase -
NFJ63_RS23195 (NFJ63_23195) 4837116..4837427 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ63_RS23200 (NFJ63_23200) 4837424..4837876 + 453 WP_103767199.1 helix-turn-helix domain-containing protein -
NFJ63_RS23205 (NFJ63_23205) 4837894..4838835 - 942 WP_049282313.1 fatty acid biosynthesis protein FabY -
NFJ63_RS23210 (NFJ63_23210) 4838880..4839317 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFJ63_RS23215 (NFJ63_23215) 4839314..4840186 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ63_RS23220 (NFJ63_23220) 4840180..4840779 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248809 WP_016155182.1 NZ_CP099385:c4835655-4835281 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248809 WP_016155181.1 NZ_CP099385:c4835897-4835655 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References