Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4835281..4835897 | Replicon | chromosome |
| Accession | NZ_CP099385 | ||
| Organism | Citrobacter braakii strain RHB09-SO-C07 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NFJ63_RS23180 | Protein ID | WP_016155182.1 |
| Coordinates | 4835281..4835655 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | R8WIS4 |
| Locus tag | NFJ63_RS23185 | Protein ID | WP_016155181.1 |
| Coordinates | 4835655..4835897 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ63_RS23165 (NFJ63_23165) | 4832784..4833686 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| NFJ63_RS23170 (NFJ63_23170) | 4833683..4834318 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ63_RS23175 (NFJ63_23175) | 4834315..4835244 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ63_RS23180 (NFJ63_23180) | 4835281..4835655 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ63_RS23185 (NFJ63_23185) | 4835655..4835897 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
| NFJ63_RS23190 (NFJ63_23190) | 4836102..4837031 | + | 930 | WP_047497507.1 | alpha/beta hydrolase | - |
| NFJ63_RS23195 (NFJ63_23195) | 4837116..4837427 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | - |
| NFJ63_RS23200 (NFJ63_23200) | 4837424..4837876 | + | 453 | WP_103767199.1 | helix-turn-helix domain-containing protein | - |
| NFJ63_RS23205 (NFJ63_23205) | 4837894..4838835 | - | 942 | WP_049282313.1 | fatty acid biosynthesis protein FabY | - |
| NFJ63_RS23210 (NFJ63_23210) | 4838880..4839317 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ63_RS23215 (NFJ63_23215) | 4839314..4840186 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFJ63_RS23220 (NFJ63_23220) | 4840180..4840779 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13678.84 Da Isoelectric Point: 8.5373
>T248809 WP_016155182.1 NZ_CP099385:c4835655-4835281 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|