Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4361732..4362258 | Replicon | chromosome |
| Accession | NZ_CP099385 | ||
| Organism | Citrobacter braakii strain RHB09-SO-C07 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NFJ63_RS21010 | Protein ID | WP_000323025.1 |
| Coordinates | 4361971..4362258 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NFJ63_RS21005 | Protein ID | WP_000534858.1 |
| Coordinates | 4361732..4361971 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ63_RS20985 (NFJ63_20980) | 4357791..4359131 | + | 1341 | WP_000589001.1 | ISNCY family transposase | - |
| NFJ63_RS20990 (NFJ63_20985) | 4359774..4360346 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| NFJ63_RS20995 (NFJ63_20990) | 4360546..4361469 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| NFJ63_RS21000 (NFJ63_20995) | 4361603..4361707 | - | 105 | Protein_4120 | protein YdfV | - |
| NFJ63_RS21005 (NFJ63_21000) | 4361732..4361971 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NFJ63_RS21010 (NFJ63_21005) | 4361971..4362258 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NFJ63_RS21015 (NFJ63_21010) | 4362684..4362890 | + | 207 | WP_001585285.1 | AlpA family transcriptional regulator | - |
| NFJ63_RS21020 (NFJ63_21015) | 4362988..4363587 | + | 600 | WP_089513907.1 | hypothetical protein | - |
| NFJ63_RS21025 (NFJ63_21020) | 4363779..4364348 | + | 570 | WP_042017752.1 | inovirus-type Gp2 protein | - |
| NFJ63_RS21030 (NFJ63_21025) | 4364739..4366520 | - | 1782 | WP_001585282.1 | ATP-dependent helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | hcp/tssD | 4345883..4374283 | 28400 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T248808 WP_000323025.1 NZ_CP099385:4361971-4362258 [Citrobacter braakii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|