Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4349734..4350452 Replicon chromosome
Accession NZ_CP099385
Organism Citrobacter braakii strain RHB09-SO-C07

Toxin (Protein)


Gene name ykfI Uniprot ID A0A1X0YHY7
Locus tag NFJ63_RS20920 Protein ID WP_001585300.1
Coordinates 4349734..4350075 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFJ63_RS20925 Protein ID WP_001585299.1
Coordinates 4350096..4350452 (-) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ63_RS20890 (NFJ63_20885) 4345458..4345820 + 363 WP_279272120.1 endoribonuclease SymE -
NFJ63_RS20895 (NFJ63_20890) 4345883..4346368 - 486 WP_016151545.1 type VI secretion system tube protein TssD -
NFJ63_RS20900 (NFJ63_20895) 4346387..4346713 - 327 WP_016155588.1 DUF1493 family protein -
NFJ63_RS20905 (NFJ63_20900) 4346707..4347156 - 450 WP_003830103.1 hypothetical protein -
NFJ63_RS20910 (NFJ63_20905) 4347415..4348287 + 873 WP_153689762.1 HNH endonuclease -
NFJ63_RS20915 (NFJ63_20910) 4348468..4349475 - 1008 WP_089513899.1 restriction endonuclease -
NFJ63_RS20920 (NFJ63_20915) 4349734..4350075 - 342 WP_001585300.1 TA system toxin CbtA family protein Toxin
NFJ63_RS20925 (NFJ63_20920) 4350096..4350452 - 357 WP_001585299.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFJ63_RS20930 (NFJ63_20925) 4350478..4350699 - 222 WP_001585298.1 DUF987 domain-containing protein -
NFJ63_RS20935 (NFJ63_20930) 4350713..4351159 - 447 WP_024195516.1 DNA repair protein RadC -
NFJ63_RS20940 (NFJ63_20935) 4351254..4351724 - 471 WP_001585296.1 antirestriction protein -
NFJ63_RS20945 (NFJ63_20940) 4351803..4352624 - 822 WP_001585295.1 DUF932 domain-containing protein -
NFJ63_RS20950 (NFJ63_20945) 4352714..4353544 - 831 WP_233609026.1 hypothetical protein -
NFJ63_RS20955 (NFJ63_20950) 4353717..4354127 - 411 WP_001585292.1 hypothetical protein -
NFJ63_RS20960 (NFJ63_20955) 4354243..4354458 - 216 WP_089513905.1 transposase -
NFJ63_RS20965 (NFJ63_20960) 4354471..4354620 - 150 WP_163396817.1 hypothetical protein -
NFJ63_RS20970 (NFJ63_20965) 4354622..4355329 - 708 WP_001585289.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - hcp/tssD 4345883..4374283 28400


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12932.96 Da        Isoelectric Point: 8.9815

>T248807 WP_001585300.1 NZ_CP099385:c4350075-4349734 [Citrobacter braakii]
MKFLLATNLRSAKPCLSSVAVWQMLLERLLEKHYGLTLNDTPFSDETVIHEHIDAGISLADAVNLLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ

Download         Length: 342 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 13284.01 Da        Isoelectric Point: 6.4588

>AT248807 WP_001585299.1 NZ_CP099385:c4350452-4350096 [Citrobacter braakii]
MNNHSESGTTPENTSCPQWGLKRAITPCFGARLVQEGNRLHFLPDRAGFNCAFSDDDSLRLDQAFPLILKQLELMLTSRE
LSPRYQHCVTLYHNGLTCEADTLGSCGYVYIAVYPTQR

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X0YHY7

Antitoxin

Source ID Structure

References