Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4308139..4308715 | Replicon | chromosome |
Accession | NZ_CP099385 | ||
Organism | Citrobacter braakii strain RHB09-SO-C07 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | NFJ63_RS20715 | Protein ID | WP_049282566.1 |
Coordinates | 4308428..4308715 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
Locus tag | NFJ63_RS20710 | Protein ID | WP_016155614.1 |
Coordinates | 4308139..4308441 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ63_RS20695 (NFJ63_20690) | 4304634..4304828 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
NFJ63_RS20700 (NFJ63_20695) | 4304841..4305797 | + | 957 | WP_115191028.1 | GTPase | - |
NFJ63_RS20705 (NFJ63_20700) | 4305984..4307831 | + | 1848 | WP_153689754.1 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
NFJ63_RS20710 (NFJ63_20705) | 4308139..4308441 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
NFJ63_RS20715 (NFJ63_20710) | 4308428..4308715 | - | 288 | WP_049282566.1 | BrnT family toxin | Toxin |
NFJ63_RS20720 (NFJ63_20715) | 4308949..4310115 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
NFJ63_RS20725 (NFJ63_20720) | 4310211..4310357 | + | 147 | Protein_4065 | type I restriction endonuclease subunit R | - |
NFJ63_RS20730 (NFJ63_20725) | 4310287..4310604 | + | 318 | Protein_4066 | endoribonuclease SymE | - |
NFJ63_RS20735 (NFJ63_20730) | 4310699..4311190 | - | 492 | Protein_4067 | type VI secretion system tube protein TssD | - |
NFJ63_RS20740 (NFJ63_20735) | 4311191..4311697 | - | 507 | WP_049282567.1 | hypothetical protein | - |
NFJ63_RS20745 (NFJ63_20740) | 4311697..4312128 | - | 432 | WP_228522538.1 | DUF2778 domain-containing protein | - |
NFJ63_RS20750 (NFJ63_20745) | 4312334..4313398 | - | 1065 | WP_153689755.1 | DUF2955 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11350.73 Da Isoelectric Point: 7.5237
>T248806 WP_049282566.1 NZ_CP099385:c4308715-4308428 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQDRYENSEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQDRYENSEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|