Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3720424..3721044 | Replicon | chromosome |
Accession | NZ_CP099385 | ||
Organism | Citrobacter braakii strain RHB09-SO-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ63_RS17965 | Protein ID | WP_002892050.1 |
Coordinates | 3720826..3721044 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
Locus tag | NFJ63_RS17960 | Protein ID | WP_019076175.1 |
Coordinates | 3720424..3720798 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ63_RS17950 (NFJ63_17945) | 3715570..3716763 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ63_RS17955 (NFJ63_17950) | 3716786..3719935 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFJ63_RS17960 (NFJ63_17955) | 3720424..3720798 | + | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ63_RS17965 (NFJ63_17960) | 3720826..3721044 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ63_RS17970 (NFJ63_17965) | 3721225..3721776 | + | 552 | WP_016152072.1 | maltose O-acetyltransferase | - |
NFJ63_RS17975 (NFJ63_17970) | 3721893..3722363 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFJ63_RS17980 (NFJ63_17975) | 3722442..3722582 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ63_RS17985 (NFJ63_17980) | 3722584..3722844 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFJ63_RS17990 (NFJ63_17985) | 3723033..3724586 | + | 1554 | WP_153690662.1 | EAL domain-containing protein | - |
NFJ63_RS17995 (NFJ63_17990) | 3724638..3724991 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFJ63_RS18000 (NFJ63_17995) | 3725056..3725685 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248805 WP_002892050.1 NZ_CP099385:3720826-3721044 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT248805 WP_019076175.1 NZ_CP099385:3720424-3720798 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6U5G9 |