Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2414061..2414697 | Replicon | chromosome |
| Accession | NZ_CP099385 | ||
| Organism | Citrobacter braakii strain RHB09-SO-C07 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ63_RS11570 | Protein ID | WP_049259794.1 |
| Coordinates | 2414061..2414249 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ63_RS11575 | Protein ID | WP_131341011.1 |
| Coordinates | 2414281..2414697 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ63_RS11550 (NFJ63_11545) | 2410839..2411069 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
| NFJ63_RS11555 (NFJ63_11550) | 2411259..2411384 | - | 126 | WP_279272241.1 | DUF2474 domain-containing protein | - |
| NFJ63_RS11560 (NFJ63_11555) | 2411384..2412394 | - | 1011 | WP_049282401.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ63_RS11565 (NFJ63_11560) | 2412394..2413797 | - | 1404 | WP_279272242.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ63_RS11570 (NFJ63_11565) | 2414061..2414249 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ63_RS11575 (NFJ63_11570) | 2414281..2414697 | + | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ63_RS11580 (NFJ63_11575) | 2414790..2416199 | + | 1410 | WP_153690353.1 | PLP-dependent aminotransferase family protein | - |
| NFJ63_RS11585 (NFJ63_11580) | 2416529..2417674 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ63_RS11590 (NFJ63_11585) | 2417691..2418707 | + | 1017 | WP_153690354.1 | ABC transporter ATP-binding protein | - |
| NFJ63_RS11595 (NFJ63_11590) | 2418708..2419652 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248800 WP_049259794.1 NZ_CP099385:2414061-2414249 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248800 WP_131341011.1 NZ_CP099385:2414281-2414697 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|