Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 845927..846581 | Replicon | chromosome |
Accession | NZ_CP099385 | ||
Organism | Citrobacter braakii strain RHB09-SO-C07 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFJ63_RS04115 | Protein ID | WP_016154348.1 |
Coordinates | 846174..846581 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFJ63_RS04110 | Protein ID | WP_016154349.1 |
Coordinates | 845927..846193 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ63_RS04085 (NFJ63_04085) | 841139..842572 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ63_RS04090 (NFJ63_04090) | 842694..843422 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFJ63_RS04095 (NFJ63_04095) | 843475..843786 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ63_RS04100 (NFJ63_04100) | 843950..844609 | + | 660 | WP_153690042.1 | hemolysin III family protein | - |
NFJ63_RS04105 (NFJ63_04105) | 844689..845669 | - | 981 | WP_153690043.1 | tRNA-modifying protein YgfZ | - |
NFJ63_RS04110 (NFJ63_04110) | 845927..846193 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFJ63_RS04115 (NFJ63_04115) | 846174..846581 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFJ63_RS04120 (NFJ63_04120) | 846682..847203 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFJ63_RS04125 (NFJ63_04125) | 847317..848213 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFJ63_RS04130 (NFJ63_04130) | 848237..848950 | + | 714 | WP_153690044.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ63_RS04135 (NFJ63_04135) | 848956..850689 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248799 WP_016154348.1 NZ_CP099385:846174-846581 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|