Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4677936..4678552 Replicon chromosome
Accession NZ_CP099384
Organism Citrobacter braakii strain RHB13-SO-C07

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ78_RS22085 Protein ID WP_016155182.1
Coordinates 4677936..4678310 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ78_RS22090 Protein ID WP_016155181.1
Coordinates 4678310..4678552 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ78_RS22070 (4675439) 4675439..4676341 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ78_RS22075 (4676338) 4676338..4676973 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ78_RS22080 (4676970) 4676970..4677899 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ78_RS22085 (4677936) 4677936..4678310 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ78_RS22090 (4678310) 4678310..4678552 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ78_RS22095 (4678758) 4678758..4679687 + 930 WP_094761752.1 alpha/beta hydrolase -
NFJ78_RS22100 (4679772) 4679772..4680083 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFJ78_RS22105 (4680080) 4680080..4680532 + 453 WP_141876133.1 helix-turn-helix domain-containing protein -
NFJ78_RS22110 (4680550) 4680550..4681491 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ78_RS22115 (4681536) 4681536..4681973 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
NFJ78_RS22120 (4681970) 4681970..4682842 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ78_RS22125 (4682836) 4682836..4683435 - 600 WP_016157873.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248796 WP_016155182.1 NZ_CP099384:c4678310-4677936 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248796 WP_016155181.1 NZ_CP099384:c4678552-4678310 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References