Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4162567..4163291 Replicon chromosome
Accession NZ_CP099384
Organism Citrobacter braakii strain RHB13-SO-C07

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag NFJ78_RS19755 Protein ID WP_279262589.1
Coordinates 4162567..4162929 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag NFJ78_RS19760 Protein ID WP_137495566.1
Coordinates 4162950..4163291 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ78_RS19725 (4158243) 4158243..4158605 + 363 WP_016155589.1 endoribonuclease SymE -
NFJ78_RS19730 (4158668) 4158668..4159153 - 486 WP_222186480.1 type VI secretion system tube protein TssD -
NFJ78_RS19735 (4159172) 4159172..4159498 - 327 WP_016151544.1 DUF1493 family protein -
NFJ78_RS19740 (4159492) 4159492..4159941 - 450 WP_003830103.1 hypothetical protein -
NFJ78_RS19745 (4160200) 4160200..4161072 + 873 WP_222186481.1 HNH endonuclease -
NFJ78_RS19750 (4161296) 4161296..4162303 - 1008 WP_048216873.1 restriction endonuclease -
NFJ78_RS19755 (4162567) 4162567..4162929 - 363 WP_279262589.1 TA system toxin CbtA family protein Toxin
NFJ78_RS19760 (4162950) 4162950..4163291 - 342 WP_137495566.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFJ78_RS19765 (4163302) 4163302..4163844 - 543 WP_137495565.1 DNA repair protein RadC -
NFJ78_RS19770 (4163857) 4163857..4164300 - 444 WP_127675143.1 antirestriction protein -
NFJ78_RS19775 (4164331) 4164331..4165152 - 822 WP_089186380.1 DUF932 domain-containing protein -
NFJ78_RS19780 (4165251) 4165251..4165481 - 231 WP_279262590.1 DUF905 domain-containing protein -
NFJ78_RS19785 (4165553) 4165553..4166002 - 450 WP_048216880.1 IrmA family protein -
NFJ78_RS19790 (4165999) 4165999..4166451 - 453 WP_279262591.1 hypothetical protein -
NFJ78_RS19795 (4166488) 4166488..4167057 - 570 WP_048216882.1 hypothetical protein -
NFJ78_RS19800 (4167057) 4167057..4167761 - 705 WP_048216883.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4159492..4211005 51513


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-116)

Antitoxin

Antitoxin CbeA

(13-111)


Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13348.36 Da        Isoelectric Point: 7.1649

>T248795 WP_279262589.1 NZ_CP099384:c4162929-4162567 [Citrobacter braakii]
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAGISLADAVNFLVEKYGLV
RIDRRGFDWQEQSPYLRAVDILRARQATGLLKRNRISAAR

Download         Length: 363 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12856.42 Da        Isoelectric Point: 6.2069

>AT248795 WP_137495566.1 NZ_CP099384:c4163291-4162950 [Citrobacter braakii]
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLVDRASITGEFSNAESLKLDEVFPHFISQMESMMTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAVYPTHR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References