Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4121330..4121906 | Replicon | chromosome |
| Accession | NZ_CP099384 | ||
| Organism | Citrobacter braakii strain RHB13-SO-C07 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NFJ78_RS19550 | Protein ID | WP_222186473.1 |
| Coordinates | 4121619..4121906 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
| Locus tag | NFJ78_RS19545 | Protein ID | WP_016155614.1 |
| Coordinates | 4121330..4121632 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ78_RS19530 (4117825) | 4117825..4118019 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
| NFJ78_RS19535 (4118032) | 4118032..4118988 | + | 957 | WP_053389311.1 | GTPase | - |
| NFJ78_RS19540 (4119175) | 4119175..4121022 | + | 1848 | WP_137380245.1 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
| NFJ78_RS19545 (4121330) | 4121330..4121632 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
| NFJ78_RS19550 (4121619) | 4121619..4121906 | - | 288 | WP_222186473.1 | BrnT family toxin | Toxin |
| NFJ78_RS19555 (4122137) | 4122137..4123303 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
| NFJ78_RS19560 (4123399) | 4123399..4123545 | + | 147 | Protein_3830 | type I restriction endonuclease subunit R | - |
| NFJ78_RS19565 (4123532) | 4123532..4123792 | + | 261 | Protein_3831 | endoribonuclease SymE | - |
| NFJ78_RS19570 (4123887) | 4123887..4124378 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
| NFJ78_RS19575 (4124379) | 4124379..4124885 | - | 507 | WP_016155610.1 | hypothetical protein | - |
| NFJ78_RS19580 (4124885) | 4124885..4125316 | - | 432 | WP_223952673.1 | DUF2778 domain-containing protein | - |
| NFJ78_RS19585 (4125522) | 4125522..4126586 | - | 1065 | WP_049041982.1 | DUF2955 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11334.73 Da Isoelectric Point: 7.5237
>T248794 WP_222186473.1 NZ_CP099384:c4121906-4121619 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGIRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNHRKHGIRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|