Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3581066..3581686 | Replicon | chromosome |
Accession | NZ_CP099384 | ||
Organism | Citrobacter braakii strain RHB13-SO-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ78_RS17120 | Protein ID | WP_002892050.1 |
Coordinates | 3581468..3581686 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFJ78_RS17115 | Protein ID | WP_003021733.1 |
Coordinates | 3581066..3581440 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ78_RS17105 (3576213) | 3576213..3577406 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ78_RS17110 (3577429) | 3577429..3580578 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFJ78_RS17115 (3581066) | 3581066..3581440 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ78_RS17120 (3581468) | 3581468..3581686 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ78_RS17125 (3581867) | 3581867..3582418 | + | 552 | WP_103283555.1 | maltose O-acetyltransferase | - |
NFJ78_RS17130 (3582535) | 3582535..3583005 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFJ78_RS17135 (3583084) | 3583084..3583224 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ78_RS17140 (3583226) | 3583226..3583486 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFJ78_RS17145 (3583675) | 3583675..3585228 | + | 1554 | WP_016155873.1 | EAL domain-containing protein | - |
NFJ78_RS17150 (3585280) | 3585280..3585633 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFJ78_RS17155 (3585698) | 3585698..3586327 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248793 WP_002892050.1 NZ_CP099384:3581468-3581686 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248793 WP_003021733.1 NZ_CP099384:3581066-3581440 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |