Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2879992..2880582 | Replicon | chromosome |
Accession | NZ_CP099384 | ||
Organism | Citrobacter braakii strain RHB13-SO-C07 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NFJ78_RS13820 | Protein ID | WP_049041157.1 |
Coordinates | 2879992..2880324 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NFJ78_RS13825 | Protein ID | WP_049041154.1 |
Coordinates | 2880325..2880582 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ78_RS13795 (2875028) | 2875028..2875387 | - | 360 | WP_016156204.1 | purine nucleoside phosphoramidase | - |
NFJ78_RS13800 (2875736) | 2875736..2877922 | + | 2187 | WP_181634828.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
NFJ78_RS13810 (2878257) | 2878257..2879744 | + | 1488 | WP_279262445.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NFJ78_RS13820 (2879992) | 2879992..2880324 | - | 333 | WP_049041157.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFJ78_RS13825 (2880325) | 2880325..2880582 | - | 258 | WP_049041154.1 | antitoxin | Antitoxin |
NFJ78_RS13830 (2881193) | 2881193..2885092 | + | 3900 | WP_279262446.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11731.54 Da Isoelectric Point: 8.5572
>T248792 WP_049041157.1 NZ_CP099384:c2880324-2879992 [Citrobacter braakii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|