Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 872802..873456 | Replicon | chromosome |
Accession | NZ_CP099384 | ||
Organism | Citrobacter braakii strain RHB13-SO-C07 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFJ78_RS04255 | Protein ID | WP_016154348.1 |
Coordinates | 873049..873456 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFJ78_RS04250 | Protein ID | WP_016154349.1 |
Coordinates | 872802..873068 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ78_RS04225 (868015) | 868015..869448 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ78_RS04230 (869569) | 869569..870297 | - | 729 | WP_103284472.1 | MurR/RpiR family transcriptional regulator | - |
NFJ78_RS04235 (870350) | 870350..870661 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ78_RS04240 (870825) | 870825..871484 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFJ78_RS04245 (871564) | 871564..872544 | - | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
NFJ78_RS04250 (872802) | 872802..873068 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFJ78_RS04255 (873049) | 873049..873456 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFJ78_RS04260 (873557) | 873557..874078 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFJ78_RS04265 (874192) | 874192..875088 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFJ78_RS04270 (875112) | 875112..875825 | + | 714 | WP_075847456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ78_RS04275 (875831) | 875831..877564 | + | 1734 | WP_049269301.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248786 WP_016154348.1 NZ_CP099384:873049-873456 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|