Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 687753..688432 | Replicon | chromosome |
Accession | NZ_CP099384 | ||
Organism | Citrobacter braakii strain RHB13-SO-C07 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | NFJ78_RS03325 | Protein ID | WP_222186296.1 |
Coordinates | 688091..688432 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NFJ78_RS03320 | Protein ID | WP_222186295.1 |
Coordinates | 687753..688070 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ78_RS03280 (683134) | 683134..684081 | + | 948 | WP_222186287.1 | ankyrin repeat domain-containing protein | - |
NFJ78_RS03285 (684247) | 684247..685110 | + | 864 | WP_222186288.1 | GTPase family protein | - |
NFJ78_RS03290 (685202) | 685202..685612 | + | 411 | Protein_645 | DUF932 domain-containing protein | - |
NFJ78_RS03295 (685667) | 685667..686140 | + | 474 | WP_222186292.1 | hypothetical protein | - |
NFJ78_RS03300 (686218) | 686218..686457 | + | 240 | WP_222186293.1 | DUF905 domain-containing protein | - |
NFJ78_RS03305 (686554) | 686554..687012 | + | 459 | WP_222186294.1 | antirestriction protein | - |
NFJ78_RS03310 (687028) | 687028..687504 | + | 477 | WP_218733310.1 | RadC family protein | - |
NFJ78_RS03315 (687513) | 687513..687734 | + | 222 | WP_218733312.1 | DUF987 domain-containing protein | - |
NFJ78_RS03320 (687753) | 687753..688070 | + | 318 | WP_222186295.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ78_RS03325 (688091) | 688091..688432 | + | 342 | WP_222186296.1 | TA system toxin CbtA family protein | Toxin |
NFJ78_RS03330 (688549) | 688549..689382 | + | 834 | WP_222186297.1 | DUF4942 domain-containing protein | - |
NFJ78_RS03340 (689686) | 689686..690192 | + | 507 | WP_019077714.1 | G/U mismatch-specific DNA glycosylase | - |
NFJ78_RS03345 (690238) | 690238..692082 | - | 1845 | WP_016154549.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12842.87 Da Isoelectric Point: 8.9788
>T248785 WP_222186296.1 NZ_CP099384:688091-688432 [Citrobacter braakii]
MKTLPATTPQAAKLCLPPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVDKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNKPVR
MKTLPATTPQAAKLCLPPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVDKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNKPVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|